StarFunc result for job id P55895

User Input

>input (527 residues)
MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPT
IFSKDSCYLPPLRYPATCTFKGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV
TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLP
CVFLVDFEFGCATSYILPELQDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL
PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMICNIISLEDNKIEIR
EMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT
TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGYWITCC
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE
HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55895	1.000	1.000	4.143E-97	527	1.000	1.000	P55895.pdb.gz	RAG2_HUMAN V(D)J recombination-activating protein 2 OS=Homo sapiens OX=9606 GN=RAG2 PE=1 SV=1
2	AFDB:G3V6K7	0.916	0.916	1.483E-85	527	0.892	0.892	G3V6K7.pdb.gz	G3V6K7_RAT V(D)J recombination-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Rag2 PE=3 SV=1
3	AFDB:O13034	0.768	0.764	3.583E-60	530	0.491	0.489	O13034.pdb.gz	RAG2_DANRE V(D)J recombination-activating protein 2 OS=Danio rerio OX=7955 GN=rag2 PE=1 SV=1
4	PDB:6oemB	0.648	0.983	2.857E-56	346	0.584	0.890	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
5	PDB:6dbjD	0.644	0.959	7.516E-45	352	0.336	0.503	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
6	AFDB:Q9W281	0.338	0.276	4.633E-12	667	0.112	0.088	Q9W281.pdb.gz	Q9W281_DROME GH02866p OS=Drosophila melanogaster OX=7227 GN=Fbxo42 PE=2 SV=1
7	PDB:2zwaB	0.426	0.340	9.472E-12	683	0.078	0.060	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
8	AFDB:Q6P3S6	0.370	0.281	1.010E-10	717	0.121	0.089	Q6P3S6.pdb.gz	FBX42_HUMAN F-box only protein 42 OS=Homo sapiens OX=9606 GN=FBXO42 PE=1 SV=1
9	PDB:5gq0A	0.420	0.610	1.769E-10	338	0.091	0.142	5gq0A.pdb.gz
10	PDB:2uvkB	0.365	0.515	2.983E-9	349	0.076	0.115	2uvkB.pdb.gz
11	PDB:5gqtA	0.414	0.456	3.305E-9	470	0.074	0.083	5gqtA.pdb.gz
12	PDB:7pi3A	0.339	0.484	2.858E-8	328	0.070	0.113	7pi3A.pdb.gz	Heterotypic interactions drive antibody synergy against a malaria vaccine candidate.
13	PDB:6qk7B	0.217	0.165	1.928E-6	749	0.053	0.037	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
14	PDB:5jozA	0.284	0.292	7.713E-6	507	0.091	0.095	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
15	PDB:5y31B	0.295	0.302	2.047E-5	511	0.051	0.053	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	AFDB:P25365	0.273	0.158	2.656E-5	1065	0.120	0.059	P25365.pdb.gz	SED4_YEAST Putative guanine nucleotide-exchange factor SED4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SED4 PE=1 SV=1
17	AFDB:Q8H0T9	0.254	0.176	1.305E-4	837	0.116	0.073	Q8H0T9.pdb.gz	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
18	AFDB:E7F5M0	0.251	0.130	1.776E-4	1218	0.110	0.048	E7F5M0.pdb.gz
19	AFDB:P33215	0.227	0.190	2.545E-4	660	0.118	0.094	P33215.pdb.gz	NEDD1_MOUSE Protein NEDD1 OS=Mus musculus OX=10090 GN=Nedd1 PE=1 SV=2
20	AFDB:Q9VQ36	0.283	0.178	4.477E-4	951	0.063	0.035	Q9VQ36.pdb.gz	FRITZ_DROME WD repeat-containing and planar cell polarity effector protein fritz OS=Drosophila melanogaster OX=7227 GN=frtz PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V6K7	0.0	1009	527	0.892	0.892	G3V6K7_RAT V(D)J recombination-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Rag2 PE=3 SV=1
2	O13034	0.0	567	530	0.516	0.513	RAG2_DANRE V(D)J recombination-activating protein 2 OS=Danio rerio OX=7955 GN=rag2 PE=1 SV=1
3	P21784	0.0	1004	527	0.884	0.884	RAG2_MOUSE V(D)J recombination-activating protein 2 OS=Mus musculus OX=10090 GN=Rag2 PE=1 SV=2
4	P55895	0.0	1105	527	1.000	1.000	RAG2_HUMAN V(D)J recombination-activating protein 2 OS=Homo sapiens OX=9606 GN=RAG2 PE=1 SV=1
5	Q6W9A2	0.0	594	307	0.528	0.906	Q6W9A2_RAT V(D)J recombination-activating protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rag2 PE=3 SV=1
6	Q99NM1	2.02e-97	293	148	0.262	0.932	Q99NM1_RAT Recombination activating protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rag2 PE=4 SV=1
7	Q9CQ33	0.21	37.0	837	0.040	0.025	LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus OX=10090 GN=Lztr1 PE=1 SV=2
8	Q8N653	0.24	36.6	840	0.042	0.026	LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens OX=9606 GN=LZTR1 PE=1 SV=2
9	Q7M3S9	0.34	36.2	943	0.066	0.037	RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum OX=44689 GN=rngB PE=2 SV=2
10	Q388N7	2.6	33.1	732	0.040	0.029	Q388N7_TRYB2 DZANK-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0060 PE=4 SV=1
11	Q8L7U5	3.5	33.1	881	0.042	0.025	BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana OX=3702 GN=BSL1 PE=1 SV=2
12	P36106	3.7	32.7	594	0.040	0.035	BYE1_YEAST Transcription factor BYE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BYE1 PE=1 SV=1
13	P78316	3.9	32.7	857	0.046	0.028	NOP14_HUMAN Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3
14	P50090	4.6	32.7	882	0.049	0.029	KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KEL2 PE=1 SV=1
15	E9PFK5	4.8	32.3	788	0.046	0.030	E9PFK5_HUMAN NOP14 nucleolar protein OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=1
16	F1MA98	5.7	32.3	2360	0.049	0.011	TPR_RAT Nucleoprotein TPR OS=Rattus norvegicus OX=10116 GN=Tpr PE=1 SV=1
17	Q10AZ7	6.9	32.0	501	0.042	0.044	GPA3_ORYSJ Protein GLUTELIN PRECURSOR ACCUMULATION 3 OS=Oryza sativa subsp. japonica OX=39947 GN=GPA3 PE=1 SV=1
18	Q8LRK8	6.9	32.0	682	0.040	0.031	HDA18_ARATH Histone deacetylase 18 OS=Arabidopsis thaliana OX=3702 GN=HDA18 PE=1 SV=1
19	Q9LZ83	9.9	31.2	514	0.032	0.033	Q9LZ83_ARATH AT5G04420 protein OS=Arabidopsis thaliana OX=3702 GN=T32M21_20 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13585 CHU_C	2.9e+02	13.0	CHU_C Type IX secretion signal domain
2	PF13415 Kelch_3	0.21	23.2	Galactose oxidase, central domain
3	PF13418 Kelch_4	0.12	23.7	Galactose oxidase, central domain
4	PF13854 Kelch_5	0.078	24.1	Kelch motif
5	PF00628 PHD	2.2e+02	13.2	PHD-finger
6	PF03089 RAG2	3.4e-188	636.3	Recombination activating protein 2
7	PF13341 RAG2_PHD	1e-43	158.6	RAG2 PHD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299440	0.999	V(D)J recombination-activating protein 1
2	9606.ENSP00000476960	0.991	Histone cluster 2 H3 pseudogene 2
3	9606.ENSP00000368880	0.937	Forkhead box protein O1
4	9606.ENSP00000330753	0.908	Bromodomain and WD repeat-containing protein 1
5	9606.ENSP00000354554	0.846	Cytochrome b
6	9606.ENSP00000363318	0.796	Cytokine receptor common subunit gamma
7	9606.ENSP00000345347	0.786	High mobility group protein B1
8	9606.ENSP00000011653	0.757	T-cell surface glycoprotein CD4
9	9606.ENSP00000310722	0.729	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family
10	9606.ENSP00000478289	0.707	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
11	9606.ENSP00000354499	0.698	Cytochrome c oxidase subunit 1
12	9606.ENSP00000386559	0.696	T-cell surface glycoprotein CD8 alpha chain
13	9606.ENSP00000411355	0.693	Receptor-type tyrosine-protein phosphatase C
14	9606.ENSP00000310036	0.683	Hematopoietic progenitor cell antigen CD34
15	9606.ENSP00000328181	0.672	Noggin
16	9606.ENSP00000385361	0.671	Immunoglobulin iota chain
17	9606.ENSP00000263851	0.665	Interleukin-7
18	9606.ENSP00000337825	0.661	Tyrosine-protein kinase Lck
19	9606.ENSP00000306157	0.653	Interleukin-7 receptor subunit alpha
20	9606.ENSP00000313420	0.651	DNA-dependent protein kinase catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.998	catalytic activity
GO:0005515	0.998	protein binding
GO:0019787	0.983	ubiquitin-like protein transferase activity
GO:0035091	0.979	phosphatidylinositol binding
GO:0035064	0.972	methylated histone binding
GO:0003682	0.971	chromatin binding
GO:0046914	0.966	transition metal ion binding
GO:0043168	0.961	anion binding
GO:0004842	0.961	ubiquitin-protein transferase activity
GO:0008270	0.961	zinc ion binding
GO:1901981	0.935	phosphatidylinositol phosphate binding
GO:0061659	0.934	ubiquitin-like protein ligase activity
GO:1902936	0.928	phosphatidylinositol bisphosphate binding
GO:0005546	0.924	phosphatidylinositol-4,5-bisphosphate binding
GO:0043325	0.918	phosphatidylinositol-3,4-bisphosphate binding
GO:0005547	0.918	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0061630	0.917	ubiquitin protein ligase activity
GO:0080025	0.917	phosphatidylinositol-3,5-bisphosphate binding
GO:0097159	0.886	organic cyclic compound binding
GO:1901363	0.885	heterocyclic compound binding
GO:0003676	0.878	nucleic acid binding
GO:0003677	0.849	DNA binding
GO:0043565	0.786	sequence-specific DNA binding
GO:0004536	0.491	deoxyribonuclease activity
GO:0004520	0.472	DNA endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0065007	0.976	biological regulation
GO:0050896	0.973	response to stimulus
GO:0050794	0.970	regulation of cellular process
GO:0030183	0.954	B cell differentiation
GO:0051239	0.924	regulation of multicellular organismal process
GO:0050793	0.915	regulation of developmental process
GO:0002366	0.913	leukocyte activation involved in immune response
GO:0002285	0.898	lymphocyte activation involved in immune response
GO:0048523	0.883	negative regulation of cellular process
GO:0022407	0.875	regulation of cell-cell adhesion
GO:0051249	0.869	regulation of lymphocyte activation
GO:1903037	0.825	regulation of leukocyte cell-cell adhesion
GO:0050863	0.819	regulation of T cell activation
GO:1903706	0.817	regulation of hemopoiesis
GO:0048518	0.808	positive regulation of biological process
GO:1902105	0.797	regulation of leukocyte differentiation
GO:0045619	0.754	regulation of lymphocyte differentiation
GO:0045580	0.719	regulation of T cell differentiation
GO:0007162	0.715	negative regulation of cell adhesion
GO:0051250	0.713	negative regulation of lymphocyte activation
GO:1902106	0.704	negative regulation of leukocyte differentiation
GO:1903038	0.702	negative regulation of leukocyte cell-cell adhesion
GO:0008152	0.675	metabolic process
GO:0050868	0.672	negative regulation of T cell activation
GO:0045581	0.646	negative regulation of T cell differentiation
GO:0002312	0.634	B cell activation involved in immune response
GO:0071704	0.621	organic substance metabolic process
GO:0019222	0.613	regulation of metabolic process
GO:0006807	0.599	nitrogen compound metabolic process
GO:0044238	0.565	primary metabolic process
GO:0060255	0.556	regulation of macromolecule metabolic process
GO:0044237	0.551	cellular metabolic process
GO:0043170	0.525	macromolecule metabolic process
GO:0010468	0.410	regulation of gene expression
GO:0051716	0.396	cellular response to stimulus
GO:0006950	0.391	response to stress
GO:0006259	0.363	DNA metabolic process
GO:0042110	0.360	T cell activation
GO:0007275	0.338	multicellular organism development
GO:0048522	0.330	positive regulation of cellular process
GO:0031323	0.311	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.520	membrane
GO:0005737	0.359	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.983	Transferases.
EC:3.1.-.-	0.491	Acting on ester bonds.

[back to server]