StarFunc result for job id P55957

User Input

>input (195 residues)
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8ASI8	0.951	0.951	1.630E-25	195	1.000	1.000	A8ASI8.pdb.gz	A8ASI8_HUMAN BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=2 SV=1
2	PDB:2bidA	0.620	0.615	6.017E-19	197	1.000	0.990	2bidA.pdb.gz
3	AFDB:P70444	0.840	0.840	5.763E-18	195	0.641	0.641	P70444.pdb.gz	BID_MOUSE BH3-interacting domain death agonist OS=Mus musculus OX=10090 GN=Bid PE=1 SV=2
4	AFDB:Q9JLT6	0.852	0.847	1.580E-17	196	0.621	0.617	Q9JLT6.pdb.gz	BID_RAT BH3-interacting domain death agonist OS=Rattus norvegicus OX=10116 GN=Bid PE=1 SV=2
5	PDB:1ddbA	0.550	0.550	2.705E-11	195	0.651	0.651	1ddbA.pdb.gz
6	AFDB:A0A2R8QUD1	0.468	0.485	4.040E-4	187	0.174	0.182	A0A2R8QUD1.pdb.gz
7	PDB:7cclC	0.473	0.598	5.650E-3	147	0.123	0.163	7cclC.pdb.gz
8	AFDB:Q08ED0	0.501	0.574	6.236E-3	167	0.159	0.186	Q08ED0.pdb.gz	B2L15_MOUSE Bcl-2-like protein 15 OS=Mus musculus OX=10090 GN=Bcl2l15 PE=2 SV=2
9	AFDB:Q90Z98	0.481	0.411	4.256E-2	238	0.097	0.080	Q90Z98.pdb.gz	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
10	AFDB:O35425	0.422	0.393	4.465E-2	213	0.144	0.131	O35425.pdb.gz	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
11	AFDB:P53563	0.421	0.366	4.465E-2	233	0.123	0.103	P53563.pdb.gz	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
12	AFDB:O35843	0.408	0.354	5.157E-2	235	0.118	0.098	O35843.pdb.gz	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
13	AFDB:Q7TS60	0.352	0.325	6.557E-2	219	0.097	0.087	Q7TS60.pdb.gz	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
14	PDB:4wmuA	0.395	0.180	8.740E-1	516	0.097	0.037	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
15	PDB:8dr0D	0.167	0.101	9.621E-1	344	0.062	0.035	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
16	PDB:7z6hD	0.165	0.105	1.059	324	0.072	0.043	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
17	PDB:1yviA	0.180	0.235	1.111	140	0.123	0.171	1yviA.pdb.gz
18	PDB:6zh5A	0.143	0.151	1.632	178	0.149	0.163	6zh5A.pdb.gz
19	PDB:6jlyG	0.204	0.120	1.884	363	0.097	0.052	6jlyG.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
20	PDB:2fg8A	0.141	0.152	1.977	174	0.118	0.132	2fg8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8ASI8	5.15e-144	400	195	1.000	1.000	A8ASI8_HUMAN BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=2 SV=1
2	P55957	5.15e-144	400	195	1.000	1.000	BID_HUMAN BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1
3	P70444	1.03e-77	232	195	0.656	0.656	BID_MOUSE BH3-interacting domain death agonist OS=Mus musculus OX=10090 GN=Bid PE=1 SV=2
4	Q9JLT6	1.84e-74	224	196	0.621	0.617	BID_RAT BH3-interacting domain death agonist OS=Rattus norvegicus OX=10116 GN=Bid PE=1 SV=2
5	Q1LX52	0.014	37.4	187	0.128	0.134	Q1LX52_DANRE BH3-interacting domain death agonist OS=Danio rerio OX=7955 GN=bid PE=1 SV=1
6	Q38DK9	1.8	32.0	1275	0.169	0.026	Q38DK9_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2970 PE=3 SV=1
7	P9WQI3	2.3	31.2	393	0.087	0.043	SUGC_MYCTU Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sugC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	2.1e+02	13.9	Apoptosis regulator proteins, Bcl-2 family
2	PF06393 BID	7e-90	311.2	BH3 interacting domain (BID)
3	PF08767 CRM1_C	2.3e+02	12.3	CRM1 C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318822

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293288	0.998	Apoptosis regulator BAX
2	9606.ENSP00000302564	0.994	Bcl-2-like protein 1
3	9606.ENSP00000351273	0.994	Caspase-8
4	9606.ENSP00000363591	0.993	Bcl-2 homologous antagonist/killer
5	9606.ENSP00000358022	0.990	Induced myeloid leukemia cell differentiation protein Mcl-1
6	9606.ENSP00000381185	0.989	Apoptosis regulator Bcl-2
7	9606.ENSP00000301838	0.986	FAS-associated death domain protein
8	9606.ENSP00000347979	0.982	Tumor necrosis factor receptor superfamily member 6
9	9606.ENSP00000356694	0.982	Tumor necrosis factor ligand superfamily member 6
10	9606.ENSP00000286186	0.974	Caspase-10
11	9606.ENSP00000307786	0.969	Cytochrome c
12	9606.ENSP00000267953	0.964	Bcl-2-related protein A1
13	9606.ENSP00000276431	0.963	Tumor necrosis factor receptor superfamily member 10B
14	9606.ENSP00000162749	0.955	Tumor necrosis factor receptor superfamily member 1A
15	9606.ENSP00000216341	0.955	Granzyme B
16	9606.ENSP00000376943	0.952	Bcl-2-like protein 11
17	9606.ENSP00000241261	0.948	Tumor necrosis factor ligand superfamily member 10
18	9606.ENSP00000221132	0.944	Tumor necrosis factor receptor superfamily member 10A
19	9606.ENSP00000269305	0.944	Cellular tumor antigen p53
20	9606.ENSP00000341268	0.944	Tumor necrosis factor receptor type 1-associated DEATH domain protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0032813	0.917	tumor necrosis factor receptor superfamily binding
GO:0019899	0.890	enzyme binding
GO:0005123	0.877	death receptor binding
GO:0044389	0.523	ubiquitin-like protein ligase binding
GO:0031625	0.513	ubiquitin protein ligase binding
GO:0019904	0.321	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.991	cellular process
GO:0009966	0.989	regulation of signal transduction
GO:0048522	0.986	positive regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:2001233	0.979	regulation of apoptotic signaling pathway
GO:0006915	0.978	apoptotic process
GO:0007165	0.966	signal transduction
GO:0097190	0.962	apoptotic signaling pathway
GO:0071840	0.955	cellular component organization or biogenesis
GO:0008637	0.950	apoptotic mitochondrial changes
GO:0090199	0.939	regulation of release of cytochrome c from mitochondria
GO:0033554	0.937	cellular response to stress
GO:2001235	0.931	positive regulation of apoptotic signaling pathway
GO:0097191	0.914	extrinsic apoptotic signaling pathway
GO:1902531	0.912	regulation of intracellular signal transduction
GO:0035556	0.894	intracellular signal transduction
GO:0051179	0.884	localization
GO:0010638	0.860	positive regulation of organelle organization
GO:0044087	0.849	regulation of cellular component biogenesis
GO:0044089	0.830	positive regulation of cellular component biogenesis
GO:0010822	0.825	positive regulation of mitochondrion organization
GO:2001242	0.797	regulation of intrinsic apoptotic signaling pathway
GO:1902533	0.784	positive regulation of intracellular signal transduction
GO:0031334	0.783	positive regulation of protein-containing complex assembly
GO:0042770	0.778	signal transduction in response to DNA damage
GO:0051641	0.747	cellular localization
GO:0019222	0.746	regulation of metabolic process
GO:0051234	0.686	establishment of localization
GO:1904019	0.654	epithelial cell apoptotic process
GO:0060255	0.609	regulation of macromolecule metabolic process
GO:0070997	0.603	neuron death
GO:0051171	0.565	regulation of nitrogen compound metabolic process
GO:0080090	0.553	regulation of primary metabolic process
GO:0045184	0.551	establishment of protein localization
GO:2001236	0.530	regulation of extrinsic apoptotic signaling pathway
GO:0008625	0.519	extrinsic apoptotic signaling pathway via death domain receptors
GO:0009893	0.479	positive regulation of metabolic process
GO:0008152	0.472	metabolic process
GO:0048519	0.455	negative regulation of biological process
GO:0010604	0.453	positive regulation of macromolecule metabolic process
GO:0051246	0.445	regulation of protein metabolic process
GO:0065009	0.437	regulation of molecular function
GO:0051173	0.435	positive regulation of nitrogen compound metabolic process
GO:0048523	0.434	negative regulation of cellular process
GO:0030162	0.431	regulation of proteolysis
GO:0051247	0.426	positive regulation of protein metabolic process
GO:0031323	0.415	regulation of cellular metabolic process
GO:0052547	0.415	regulation of peptidase activity
GO:2000116	0.395	regulation of cysteine-type endopeptidase activity
GO:0042221	0.391	response to chemical
GO:2001056	0.391	positive regulation of cysteine-type endopeptidase activity
GO:0010033	0.339	response to organic substance
GO:0060548	0.311	negative regulation of cell death
GO:0097435	0.302	supramolecular fiber organization
GO:0051668	0.300	localization within membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0016020	0.990	membrane
GO:0005739	0.976	mitochondrion
GO:0031090	0.836	organelle membrane
GO:0098588	0.671	bounding membrane of organelle
GO:0031968	0.643	organelle outer membrane
GO:0005741	0.625	mitochondrial outer membrane
GO:0012505	0.394	endomembrane system
GO:0032991	0.335	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]