StarFunc result for job id P56159

User Input

>input (465 residues)
MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNF
SLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSP
YEPVNSRLSDIFRVVPFISDVFQQVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTT
SVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTERRRQTIVPVCSYEEREK
PNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAYSGLIGTVMTPN
YIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPV
QTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNY
EKEGLGASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97785	0.750	0.746	4.829E-59	468	0.908	0.902	P97785.pdb.gz	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
2	AFDB:F1QDI3	0.673	0.652	2.125E-42	481	0.600	0.580	F1QDI3.pdb.gz
3	AFDB:A0A0H2UKX5	0.686	0.675	3.188E-37	473	0.578	0.569	A0A0H2UKX5.pdb.gz
4	AFDB:O00451	0.661	0.662	1.626E-34	464	0.473	0.474	O00451.pdb.gz	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
5	AFDB:B0S6A6	0.633	0.596	3.433E-31	495	0.426	0.400	B0S6A6.pdb.gz	B0S6A6_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfra2 PE=3 SV=1
6	AFDB:E7F4G1	0.660	0.670	6.454E-30	458	0.348	0.354	E7F4G1.pdb.gz	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
7	PDB:6gl7C	0.598	0.920	7.864E-26	297	0.383	0.599	6gl7C.pdb.gz
8	PDB:6q2nC	0.423	0.970	1.620E-24	200	0.430	1.000	6q2nC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
9	AFDB:O60609	0.567	0.653	2.599E-22	400	0.280	0.325	O60609.pdb.gz	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
10	AFDB:O35118	0.585	0.680	2.721E-22	397	0.273	0.320	O35118.pdb.gz	GFRA3_MOUSE GDNF family receptor alpha-3 OS=Mus musculus OX=10090 GN=Gfra3 PE=2 SV=1
11	AFDB:K9J968	0.401	0.503	3.351E-20	369	0.260	0.328	K9J968.pdb.gz	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
12	AFDB:Q9EPI2	0.428	0.718	7.077E-17	273	0.204	0.348	Q9EPI2.pdb.gz	GFRA4_RAT GDNF family receptor alpha-4 OS=Rattus norvegicus OX=10116 GN=Gfra4 PE=2 SV=2
13	PDB:6q2sC	0.393	0.898	5.708E-13	199	0.178	0.417	6q2sC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
14	PDB:7rhqG	0.123	0.322	1.108E-1	160	0.082	0.237	7rhqG.pdb.gz	Structural basis for catalyzed assembly of the Sonic hedgehog-Patched1 signaling complex.
15	PDB:6b3iA	0.117	0.155	2.647E-1	304	0.084	0.128	6b3iA.pdb.gz
16	PDB:3j6bL	0.104	0.177	5.265E-1	229	0.056	0.114	3j6bL.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:3gniA	0.127	0.162	8.327E-1	335	0.095	0.131	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
18	PDB:4o9uB	0.107	0.112	1.202	440	0.080	0.084	4o9uB.pdb.gz	Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.
19	PDB:7nj0A	0.121	0.059	1.202	1188	0.056	0.022	7nj0A.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
20	PDB:4zdrA	0.146	0.228	1.443	243	0.058	0.111	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56159	0.0	960	465	1.000	1.000	GFRA1_HUMAN GDNF family receptor alpha-1 OS=Homo sapiens OX=9606 GN=GFRA1 PE=1 SV=2
2	P97785	0.0	880	468	0.935	0.929	GFRA1_MOUSE GDNF family receptor alpha-1 OS=Mus musculus OX=10090 GN=Gfra1 PE=1 SV=2
3	Q62997	0.0	863	468	0.925	0.919	GFRA1_RAT GDNF family receptor alpha-1 OS=Rattus norvegicus OX=10116 GN=Gfra1 PE=1 SV=1
4	Q98TT8	0.0	548	481	0.591	0.572	Q98TT8_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1b PE=2 SV=2
5	Q98TT9	0.0	583	472	0.613	0.604	Q98TT9_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfralpha1a PE=1 SV=2
6	O08842	7.76e-140	411	464	0.445	0.446	GFRA2_MOUSE GDNF family receptor alpha-2 OS=Mus musculus OX=10090 GN=Gfra2 PE=1 SV=2
7	O35977	3.52e-139	409	464	0.456	0.457	O35977_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=2 SV=1
8	O00451	8.67e-139	408	464	0.467	0.468	GFRA2_HUMAN GDNF family receptor alpha-2 OS=Homo sapiens OX=9606 GN=GFRA2 PE=1 SV=2
9	A0A8I6B3J9	1.73e-138	409	506	0.449	0.413	A0A8I6B3J9_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
10	B0S6A6	4.11e-116	352	495	0.404	0.380	B0S6A6_DANRE GDNF family receptor alpha OS=Danio rerio OX=7955 GN=gfra2 PE=3 SV=1
11	A0A8I6A8G6	1.05e-93	288	331	0.312	0.438	A0A8I6A8G6_RAT GDNF family receptor alpha-2 OS=Rattus norvegicus OX=10116 GN=Gfra2 PE=3 SV=1
12	E7F4G1	3.75e-87	276	458	0.325	0.330	E7F4G1_DANRE GDNF family receptor alpha 3 OS=Danio rerio OX=7955 GN=gfra3 PE=2 SV=1
13	O35118	2.56e-53	186	397	0.254	0.297	GFRA3_MOUSE GDNF family receptor alpha-3 OS=Mus musculus OX=10090 GN=Gfra3 PE=2 SV=1
14	F7F1M3	1.39e-52	184	402	0.260	0.301	F7F1M3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=3 SV=1
15	Q6AXR3	1.76e-52	183	397	0.260	0.305	Q6AXR3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=2 SV=1
16	O60609	2.03e-52	183	400	0.254	0.295	GFRA3_HUMAN GDNF family receptor alpha-3 OS=Homo sapiens OX=9606 GN=GFRA3 PE=1 SV=2
17	K9J968	1.50e-45	164	369	0.239	0.301	K9J968_HUMAN GDNF family receptor alpha-3 variant OS=Homo sapiens OX=9606 GN=GDNFR3 PE=2 SV=1
18	Q9EPI2	1.46e-43	156	273	0.189	0.322	GFRA4_RAT GDNF family receptor alpha-4 OS=Rattus norvegicus OX=10116 GN=Gfra4 PE=2 SV=2
19	Q9JJT2	3.21e-42	152	260	0.189	0.338	GFRA4_MOUSE GDNF family receptor alpha-4 OS=Mus musculus OX=10090 GN=Gfra4 PE=2 SV=2
20	Q9GZZ7	7.89e-31	122	299	0.181	0.281	GFRA4_HUMAN GDNF family receptor alpha-4 OS=Homo sapiens OX=9606 GN=GFRA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02351 GDNF	1.2e-35	133.5	GDNF/GAS1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347942	0.999	Proto-oncogene tyrosine-protein kinase receptor Ret
2	9606.ENSP00000409007	0.999	Glial cell line-derived neurotrophic factor
3	9606.ENSP00000302648	0.996	Neurturin
4	9606.ENSP00000256509	0.980	Neural cell adhesion molecule L1-like protein
5	9606.ENSP00000387435	0.975	Artemin
6	9606.ENSP00000245810	0.974	Persephin
7	9606.ENSP00000362680	0.972	Proto-oncogene tyrosine-protein kinase Src
8	9606.ENSP00000480132	0.957	Neural cell adhesion molecule 1
9	9606.ENSP00000261769	0.942	Cadherin-1
10	9606.ENSP00000447241	0.938	Fibroblast growth factor receptor substrate 2
11	9606.ENSP00000341189	0.921	Focal adhesion kinase 1
12	9606.ENSP00000387699	0.921	Cyclic AMP-responsive element-binding protein 1
13	9606.ENSP00000401303	0.920	SHC-transforming protein 1
14	9606.ENSP00000344456	0.919	Catenin beta-1
15	9606.ENSP00000372160	0.916	Docking protein 6
16	9606.ENSP00000376345	0.912	Growth factor receptor-bound protein 2
17	9606.ENSP00000407586	0.911	GTPase HRas
18	9606.ENSP00000262593	0.909	Docking protein 5
19	9606.ENSP00000344277	0.907	Docking protein 4
20	9606.ENSP00000391669	0.906	Breast cancer anti-estrogen resistance protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	0.999	protein binding
GO:0004888	0.947	transmembrane signaling receptor activity
GO:0004896	0.931	cytokine receptor activity
GO:0005102	0.705	signaling receptor binding
GO:0016167	0.565	glial cell-derived neurotrophic factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0032501	0.991	multicellular organismal process
GO:0050794	0.991	regulation of cellular process
GO:0032502	0.986	developmental process
GO:0048856	0.982	anatomical structure development
GO:0050896	0.970	response to stimulus
GO:0007165	0.949	signal transduction
GO:0007275	0.937	multicellular organism development
GO:0048731	0.900	system development
GO:0007167	0.886	enzyme-linked receptor protein signaling pathway
GO:0007399	0.871	nervous system development
GO:0007169	0.772	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019222	0.651	regulation of metabolic process
GO:0060255	0.573	regulation of macromolecule metabolic process
GO:0031323	0.569	regulation of cellular metabolic process
GO:0080090	0.559	regulation of primary metabolic process
GO:0051171	0.511	regulation of nitrogen compound metabolic process
GO:0048518	0.489	positive regulation of biological process
GO:0048522	0.478	positive regulation of cellular process
GO:0071840	0.458	cellular component organization or biogenesis
GO:0016043	0.402	cellular component organization
GO:0048519	0.377	negative regulation of biological process
GO:0051246	0.335	regulation of protein metabolic process
GO:0048523	0.328	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005576	0.982	extracellular region
GO:0043227	0.946	membrane-bounded organelle
GO:0005622	0.833	intracellular anatomical structure
GO:0005737	0.810	cytoplasm
GO:0005615	0.781	extracellular space
GO:0043231	0.778	intracellular membrane-bounded organelle
GO:0019898	0.716	extrinsic component of membrane
GO:0032991	0.669	protein-containing complex
GO:0031982	0.459	vesicle
GO:0005829	0.452	cytosol
GO:0012505	0.379	endomembrane system
GO:0070013	0.361	intracellular organelle lumen
GO:0005634	0.315	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]