StarFunc result for job id P56177

User Input

>input (255 residues)
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSA
SSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVR
FNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR
SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSW
YPSAHQEAMQQPQLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56177	1.000	1.000	1.228E-36	255	1.000	1.000	P56177.pdb.gz	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
2	AFDB:Q98875	0.542	0.547	9.384E-29	252	0.776	0.786	Q98875.pdb.gz	DLX1A_DANRE Homeobox protein Dlx1a OS=Danio rerio OX=7955 GN=dlx1a PE=2 SV=1
3	AFDB:Q98877	0.434	0.447	2.660E-20	247	0.576	0.595	Q98877.pdb.gz	DLX6A_DANRE Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1
4	AFDB:Q98878	0.403	0.404	5.736E-18	254	0.518	0.520	Q98878.pdb.gz	DLX4B_DANRE Homeobox protein Dlx4b OS=Danio rerio OX=7955 GN=dlx4b PE=2 SV=2
5	AFDB:P56179	0.293	0.416	1.701E-14	175	0.455	0.663	P56179.pdb.gz	DLX6_HUMAN Homeobox protein DLX-6 OS=Homo sapiens OX=9606 GN=DLX6 PE=2 SV=2
6	AFDB:P50575	0.300	0.267	6.252E-13	289	0.384	0.339	P50575.pdb.gz	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
7	AFDB:Q01702	0.306	0.292	6.675E-13	269	0.384	0.364	Q01702.pdb.gz	DLX3B_DANRE Homeobox protein Dlx3b OS=Danio rerio OX=7955 GN=dlx3b PE=2 SV=1
8	AFDB:P50574	0.306	0.290	9.891E-13	270	0.392	0.370	P50574.pdb.gz	DLX2A_DANRE Homeobox protein Dlx2a OS=Danio rerio OX=7955 GN=dlx2a PE=2 SV=1
9	AFDB:P50576	0.307	0.279	2.034E-12	283	0.369	0.332	P50576.pdb.gz	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
10	AFDB:P40764	0.300	0.234	3.435E-12	332	0.396	0.304	P40764.pdb.gz	DLX2_MOUSE Homeobox protein DLX-2 OS=Mus musculus OX=10090 GN=Dlx2 PE=1 SV=1
11	PDB:4egcA	0.199	0.094	6.088E-3	539	0.063	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.190	0.594	2.934E-2	73	0.051	0.178	2hi3A.pdb.gz
13	PDB:7fbyA	0.123	0.192	1.838E-1	153	0.039	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.159	0.323	8.859E-1	113	0.055	0.124	5nr5A.pdb.gz
15	PDB:5z56L	0.172	0.131	1.078	342	0.039	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:6dv9F	0.160	0.224	1.151	174	0.043	0.063	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
17	PDB:2cjjA	0.191	0.647	1.229	63	0.043	0.175	2cjjA.pdb.gz
18	PDB:2cg4A	0.131	0.211	1.313	149	0.039	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:5mymC	0.137	0.160	1.313	205	0.051	0.063	5mymC.pdb.gz	Target Identification of Mycobacterium tuberculosis Phenotypic Hits Using a Concerted Chemogenomic, Biophysical, and Structural Approach.
20	PDB:5aj0BZ	0.135	0.310	1.402	86	0.035	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56177	0.0	517	255	1.000	1.000	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
2	Q64317	0.0	512	255	0.988	0.988	DLX1_MOUSE Homeobox protein DLX-1 OS=Mus musculus OX=10090 GN=Dlx1 PE=1 SV=1
3	X5D2F9	0.0	517	255	1.000	1.000	X5D2F9_HUMAN Distal-less homeobox 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=2 SV=1
4	Q98875	1.26e-145	409	252	0.776	0.786	DLX1A_DANRE Homeobox protein Dlx1a OS=Danio rerio OX=7955 GN=dlx1a PE=2 SV=1
5	F8VXJ2	1.03e-136	384	187	0.733	1.000	F8VXJ2_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
6	J3KP55	7.00e-123	348	171	0.671	1.000	J3KP55_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
7	Q98877	3.22e-78	238	247	0.576	0.595	DLX6A_DANRE Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1
8	P56179	1.79e-72	221	175	0.451	0.657	DLX6_HUMAN Homeobox protein DLX-6 OS=Homo sapiens OX=9606 GN=DLX6 PE=2 SV=2
9	P70397	2.71e-72	220	175	0.451	0.657	DLX6_MOUSE Homeobox protein DLX-6 OS=Mus musculus OX=10090 GN=Dlx6 PE=2 SV=3
10	Q98878	9.43e-72	222	254	0.529	0.531	DLX4B_DANRE Homeobox protein Dlx4b OS=Danio rerio OX=7955 GN=dlx4b PE=2 SV=2
11	Q92988	1.58e-44	152	240	0.447	0.475	DLX4_HUMAN Homeobox protein DLX-4 OS=Homo sapiens OX=9606 GN=DLX4 PE=1 SV=4
12	P50575	1.42e-41	145	289	0.337	0.298	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
13	P70396	1.84e-41	145	289	0.337	0.298	DLX5_MOUSE Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN=Dlx5 PE=1 SV=1
14	Q01702	6.81e-40	140	269	0.290	0.275	DLX3B_DANRE Homeobox protein Dlx3b OS=Danio rerio OX=7955 GN=dlx3b PE=2 SV=1
15	P56178	6.99e-40	141	289	0.361	0.318	DLX5_HUMAN Homeobox protein DLX-5 OS=Homo sapiens OX=9606 GN=DLX5 PE=1 SV=2
16	O60479	8.88e-39	138	287	0.282	0.251	DLX3_HUMAN Homeobox protein DLX-3 OS=Homo sapiens OX=9606 GN=DLX3 PE=1 SV=1
17	Q64205	9.16e-39	138	287	0.286	0.254	DLX3_MOUSE Homeobox protein DLX-3 OS=Mus musculus OX=10090 GN=Dlx3 PE=1 SV=1
18	P50574	2.06e-38	137	270	0.329	0.311	DLX2A_DANRE Homeobox protein Dlx2a OS=Danio rerio OX=7955 GN=dlx2a PE=2 SV=1
19	P20009	2.22e-38	138	327	0.259	0.202	DLL_DROME Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3
20	P50576	6.90e-36	130	283	0.318	0.286	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	13	17.1	Homeobox KN domain
2	PF00046 Homeodomain	5e-17	72.8	Homeodomain
3	PF15943 YdaS_antitoxin	5.2e+02	12.1	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006713

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014415	0.722	Mothers against decapentaplegic homolog
2	61853.ENSNLEP00000015131	0.642	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
3	61853.ENSNLEP00000015776	0.642	Mothers against decapentaplegic homolog
4	61853.ENSNLEP00000019400	0.638	Dachshund family transcription factor 1
5	61853.ENSNLEP00000012249	0.634	Paired box 1
6	61853.ENSNLEP00000013642	0.629	Uncharacterized protein
7	61853.ENSNLEP00000000464	0.613	Homeobox B7
8	61853.ENSNLEP00000007797	0.598	Achaete-scute family bHLH transcription factor 1
9	61853.ENSNLEP00000021689	0.586	Protein Wnt
10	61853.ENSNLEP00000020861	0.574	LIM homeobox 6
11	61853.ENSNLEP00000008069	0.572	PBX homeobox 2
12	61853.ENSNLEP00000017846	0.572	PBX homeobox 1
13	61853.ENSNLEP00000021112	0.572	PBX homeobox 3
14	61853.ENSNLEP00000011648	0.569	LIM homeobox 8
15	61853.ENSNLEP00000013788	0.566	Meis homeobox 2
16	61853.ENSNLEP00000012146	0.565	Meis homeobox 1
17	61853.ENSNLEP00000006345	0.549	Glutamate decarboxylase 1 (brain, 67kDa)
18	61853.ENSNLEP00000020298	0.538	Sp8 transcription factor
19	61853.ENSNLEP00000010475	0.530	Uncharacterized protein
20	61853.ENSNLEP00000015073	0.523	Immunoglobulin superfamily, member 9B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.989	DNA-binding transcription factor activity
GO:0000976	0.930	transcription cis-regulatory region binding
GO:0000981	0.910	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.791	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.400	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0032502	0.985	developmental process
GO:0032501	0.981	multicellular organismal process
GO:0010468	0.977	regulation of gene expression
GO:0009889	0.974	regulation of biosynthetic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0048856	0.972	anatomical structure development
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0019219	0.947	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.943	positive regulation of biological process
GO:0031326	0.923	regulation of cellular biosynthetic process
GO:0010556	0.913	regulation of macromolecule biosynthetic process
GO:0009987	0.898	cellular process
GO:0007275	0.887	multicellular organism development
GO:0051252	0.880	regulation of RNA metabolic process
GO:0006355	0.862	regulation of DNA-templated transcription
GO:0007399	0.835	nervous system development
GO:0048522	0.752	positive regulation of cellular process
GO:0009893	0.690	positive regulation of metabolic process
GO:0009891	0.622	positive regulation of biosynthetic process
GO:0048513	0.616	animal organ development
GO:0006357	0.585	regulation of transcription by RNA polymerase II
GO:0010604	0.582	positive regulation of macromolecule metabolic process
GO:0051173	0.580	positive regulation of nitrogen compound metabolic process
GO:0050896	0.547	response to stimulus
GO:0031325	0.535	positive regulation of cellular metabolic process
GO:0045935	0.515	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.512	positive regulation of DNA-templated transcription
GO:0048519	0.497	negative regulation of biological process
GO:0048523	0.478	negative regulation of cellular process
GO:0045944	0.472	positive regulation of transcription by RNA polymerase II
GO:0051172	0.454	negative regulation of nitrogen compound metabolic process
GO:0010605	0.450	negative regulation of macromolecule metabolic process
GO:0031324	0.450	negative regulation of cellular metabolic process
GO:0009890	0.410	negative regulation of biosynthetic process
GO:0045892	0.402	negative regulation of DNA-templated transcription
GO:0009653	0.373	anatomical structure morphogenesis
GO:0030154	0.315	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.988	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]