StarFunc result for job id P56178

User Input

>input (289 residues)
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCS
PTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK
EVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ
VKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAH
PPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50575	0.316	0.316	6.443E-39	289	0.962	0.962	P50575.pdb.gz	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
2	AFDB:P50576	0.295	0.301	4.795E-29	283	0.716	0.731	P50576.pdb.gz	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
3	AFDB:P40764	0.307	0.271	6.391E-18	332	0.474	0.413	P40764.pdb.gz	DLX2_MOUSE Homeobox protein DLX-2 OS=Mus musculus OX=10090 GN=Dlx2 PE=1 SV=1
4	AFDB:Q18273	0.220	0.232	8.785E-9	273	0.304	0.322	Q18273.pdb.gz	HM43_CAEEL Homeobox protein ceh-43 OS=Caenorhabditis elegans OX=6239 GN=ceh-43 PE=1 SV=1
5	AFDB:P20009	0.240	0.213	9.426E-9	327	0.336	0.297	P20009.pdb.gz	DLL_DROME Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3
6	AFDB:Q6ZNG2	0.198	0.170	2.525E-8	339	0.270	0.230	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
7	AFDB:G3UXB3	0.255	0.189	3.589E-8	402	0.235	0.169	G3UXB3.pdb.gz	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
8	AFDB:A8KB41	0.199	0.169	1.031E-7	345	0.228	0.191	A8KB41.pdb.gz	A8KB41_DANRE Homeobox protein Nkx-2.4 isoform 1 OS=Danio rerio OX=7955 GN=fi48a12 PE=2 SV=1
9	AFDB:Q9YH70	0.241	0.211	1.688E-7	334	0.246	0.213	Q9YH70.pdb.gz	Q9YH70_XENLA VENT homeobox 2, gene 2 S homeolog OS=Xenopus laevis OX=8355 GN=ventx2.2.S PE=4 SV=1
10	AFDB:Q58A08	0.202	0.170	2.400E-7	344	0.242	0.203	Q58A08.pdb.gz	Q58A08_ONCMY NK2 homeobox 1b OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4b PE=2 SV=1
11	PDB:4egcA	0.151	0.081	1.828E-2	539	0.055	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.154	0.543	2.422E-2	73	0.055	0.219	2hi3A.pdb.gz
13	PDB:7fbyA	0.130	0.227	2.470E-1	153	0.028	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2cg4A	0.132	0.237	5.356E-1	149	0.031	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
15	PDB:5nr5A	0.138	0.322	6.166E-1	113	0.052	0.133	5nr5A.pdb.gz
16	PDB:5z56L	0.151	0.129	9.405E-1	342	0.052	0.044	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:3txmA	0.117	0.098	1.083	353	0.042	0.034	3txmA.pdb.gz
18	PDB:2gqqC	0.109	0.185	1.337	157	0.028	0.051	2gqqC.pdb.gz
19	PDB:1c0wB	0.117	0.147	1.435	219	0.028	0.037	1c0wB.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
20	PDB:1c0wD	0.117	0.179	1.435	175	0.028	0.046	1c0wD.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50575	0.0	564	289	0.962	0.962	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
2	P56178	0.0	589	289	1.000	1.000	DLX5_HUMAN Homeobox protein DLX-5 OS=Homo sapiens OX=9606 GN=DLX5 PE=1 SV=2
3	P70396	0.0	567	289	0.965	0.965	DLX5_MOUSE Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN=Dlx5 PE=1 SV=1
4	P50576	4.52e-141	400	283	0.723	0.739	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
5	O60479	1.87e-78	241	287	0.509	0.512	DLX3_HUMAN Homeobox protein DLX-3 OS=Homo sapiens OX=9606 GN=DLX3 PE=1 SV=1
6	Q64205	7.18e-78	240	287	0.471	0.474	DLX3_MOUSE Homeobox protein DLX-3 OS=Mus musculus OX=10090 GN=Dlx3 PE=1 SV=1
7	Q01702	3.40e-74	230	269	0.502	0.539	DLX3B_DANRE Homeobox protein Dlx3b OS=Danio rerio OX=7955 GN=dlx3b PE=2 SV=1
8	P50574	1.21e-64	205	270	0.484	0.519	DLX2A_DANRE Homeobox protein Dlx2a OS=Danio rerio OX=7955 GN=dlx2a PE=2 SV=1
9	Q07687	5.90e-64	206	328	0.443	0.390	DLX2_HUMAN Homeobox protein DLX-2 OS=Homo sapiens OX=9606 GN=DLX2 PE=1 SV=2
10	P40764	8.14e-63	203	332	0.433	0.377	DLX2_MOUSE Homeobox protein DLX-2 OS=Mus musculus OX=10090 GN=Dlx2 PE=1 SV=1
11	P56179	1.72e-42	145	175	0.311	0.514	DLX6_HUMAN Homeobox protein DLX-6 OS=Homo sapiens OX=9606 GN=DLX6 PE=2 SV=2
12	P70397	1.93e-42	145	175	0.304	0.503	DLX6_MOUSE Homeobox protein DLX-6 OS=Mus musculus OX=10090 GN=Dlx6 PE=2 SV=3
13	Q98877	7.07e-40	141	247	0.291	0.340	DLX6A_DANRE Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1
14	Q98878	5.53e-38	136	254	0.280	0.319	DLX4B_DANRE Homeobox protein Dlx4b OS=Danio rerio OX=7955 GN=dlx4b PE=2 SV=2
15	P56177	6.37e-38	136	255	0.280	0.318	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
16	Q64317	6.37e-38	136	255	0.280	0.318	DLX1_MOUSE Homeobox protein DLX-1 OS=Mus musculus OX=10090 GN=Dlx1 PE=1 SV=1
17	X5D2F9	6.37e-38	136	255	0.280	0.318	X5D2F9_HUMAN Distal-less homeobox 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=2 SV=1
18	Q98875	3.46e-36	131	252	0.270	0.310	DLX1A_DANRE Homeobox protein Dlx1a OS=Danio rerio OX=7955 GN=dlx1a PE=2 SV=1
19	F8VXJ2	3.93e-36	129	187	0.246	0.380	F8VXJ2_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
20	P20009	1.96e-32	124	327	0.204	0.180	DLL_DROME Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12413 DLL_N	3.3e-21	87.6	Homeobox protein distal-less-like N terminal
2	PF05920 Homeobox_KN	20	16.5	Homeobox KN domain
3	PF00046 Homeodomain	1.1e-16	71.7	Homeodomain
4	PF15943 YdaS_antitoxin	3.6e+02	12.6	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360493	0.985	Runt-related transcription factor 2
2	9606.ENSP00000368104	0.968	Bone morphogenetic protein 2
3	9606.ENSP00000443827	0.874	Transcription factor Sp7
4	9606.ENSP00000239243	0.810	Homeobox protein MSX-2
5	9606.ENSP00000247182	0.747	Homeobox protein SIX1
6	9606.ENSP00000371875	0.743	Homeobox protein Nkx-3.2
7	9606.ENSP00000364847	0.722	Melanoma-associated antigen D1
8	9606.ENSP00000361664	0.716	Transcription factor HIVEP3
9	9606.ENSP00000357255	0.700	Osteocalcin
10	9606.ENSP00000219548	0.680	E3 ubiquitin-protein ligase CHIP
11	9606.ENSP00000377854	0.669	LIM/homeobox protein Lhx6
12	9606.ENSP00000415151	0.668	Core-binding factor subunit beta
13	9606.ENSP00000226284	0.662	Bone sialoprotein 2
14	9606.ENSP00000354394	0.662	Signal transducer and activator of transcription 1-alpha/beta
15	9606.ENSP00000427793	0.652	NEDD4-like E3 ubiquitin-protein ligase WWP1
16	9606.ENSP00000245451	0.643	Bone morphogenetic protein 4
17	9606.ENSP00000481021	0.642	Putative protein SEM1, isoform 2
18	9606.ENSP00000342626	0.628	Eyes absent homolog 1
19	9606.ENSP00000350928	0.611	Glutamate decarboxylase 1
20	9606.ENSP00000368683	0.603	Endothelin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0005515	0.997	protein binding
GO:0000981	0.895	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.861	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.993	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0007275	0.982	multicellular organism development
GO:0009653	0.975	anatomical structure morphogenesis
GO:0048731	0.965	system development
GO:0048518	0.964	positive regulation of biological process
GO:0007399	0.941	nervous system development
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0009893	0.929	positive regulation of metabolic process
GO:0048522	0.900	positive regulation of cellular process
GO:0001501	0.872	skeletal system development
GO:0050896	0.805	response to stimulus
GO:0010604	0.802	positive regulation of macromolecule metabolic process
GO:0009891	0.779	positive regulation of biosynthetic process
GO:0051173	0.767	positive regulation of nitrogen compound metabolic process
GO:0031325	0.767	positive regulation of cellular metabolic process
GO:0048513	0.695	animal organ development
GO:0045935	0.685	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.662	positive regulation of RNA metabolic process
GO:0010557	0.561	positive regulation of macromolecule biosynthetic process
GO:0031328	0.559	positive regulation of cellular biosynthetic process
GO:0045893	0.538	positive regulation of DNA-templated transcription
GO:0048519	0.528	negative regulation of biological process
GO:0051716	0.501	cellular response to stimulus
GO:0007154	0.474	cell communication
GO:0006357	0.451	regulation of transcription by RNA polymerase II
GO:0023052	0.448	signaling
GO:0050793	0.435	regulation of developmental process
GO:0030154	0.428	cell differentiation
GO:0007165	0.413	signal transduction
GO:0048523	0.405	negative regulation of cellular process
GO:0045944	0.391	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.785	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]