StarFunc result for job id P56180

User Input

>input (551 residues)
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVL
ARLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKL
YIPLEYRSISLAIALFFLMDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFD
IKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLT
YVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVV
RIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICS
TAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFI
IYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQF
FYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEK
MTSSDVVAGSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56180	1.000	1.000	1.046E-98	551	1.000	1.000	P56180.pdb.gz	TPTE_HUMAN Putative tyrosine-protein phosphatase TPTE OS=Homo sapiens OX=9606 GN=TPTE PE=1 SV=3
2	AFDB:Q6XPS3	0.849	0.895	2.118E-78	522	0.828	0.874	Q6XPS3.pdb.gz	TPTE2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens OX=9606 GN=TPTE2 PE=1 SV=2
3	AFDB:B3IUN7	0.683	0.729	1.216E-53	511	0.452	0.487	B3IUN7.pdb.gz
4	AFDB:F1NT98	0.535	0.692	1.079E-31	423	0.220	0.286	F1NT98.pdb.gz
5	AFDB:A0A2R8RK27	0.534	0.733	4.842E-31	398	0.211	0.291	A0A2R8RK27.pdb.gz
6	AFDB:A0A2R8Q8H3	0.531	0.689	6.273E-31	421	0.214	0.280	A0A2R8Q8H3.pdb.gz
7	AFDB:Q7ZZ56	0.532	0.728	1.513E-30	399	0.205	0.283	Q7ZZ56.pdb.gz	Q7ZZ56_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=fa11a08 PE=2 SV=1
8	AFDB:Q6TGR5	0.533	0.691	1.960E-30	422	0.211	0.275	Q6TGR5.pdb.gz
9	AFDB:E7FC59	0.533	0.626	6.790E-30	467	0.212	0.251	E7FC59.pdb.gz
10	AFDB:F1Q5Y5	0.527	0.651	9.265E-30	444	0.212	0.264	F1Q5Y5.pdb.gz
11	PDB:7jvxA	0.518	0.891	6.826E-28	314	0.220	0.385	7jvxA.pdb.gz
12	PDB:4ercA	0.240	0.826	1.660E-6	150	0.062	0.227	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
13	PDB:1fq1A	0.249	0.680	9.420E-5	183	0.042	0.126	1fq1A.pdb.gz	Phosphoprotein-protein interactions revealed by the crystal structure of kinase-associated phosphatase in complex with phosphoCDK2.
14	PDB:3s4oA	0.215	0.669	2.048E-4	163	0.047	0.160	3s4oA.pdb.gz
15	PDB:2wgpA	0.218	0.654	3.264E-4	168	0.038	0.125	2wgpA.pdb.gz
16	PDB:2gwoC	0.230	0.652	3.620E-4	174	0.047	0.149	2gwoC.pdb.gz
17	PDB:3f81A	0.226	0.615	4.453E-4	179	0.056	0.173	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
18	PDB:6d66A	0.218	0.231	1.074E-3	517	0.038	0.041	6d66A.pdb.gz
19	PDB:1r6hA	0.197	0.558	1.391E-3	172	0.051	0.163	1r6hA.pdb.gz
20	PDB:2esbA	0.202	0.602	1.465E-3	162	0.033	0.111	2esbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56180	0.0	1133	551	1.000	1.000	TPTE_HUMAN Putative tyrosine-protein phosphatase TPTE OS=Homo sapiens OX=9606 GN=TPTE PE=1 SV=3
2	Q6XPS3	0.0	890	522	0.829	0.875	TPTE2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens OX=9606 GN=TPTE2 PE=1 SV=2
3	F1QG29	3.59e-168	488	511	0.443	0.477	F1QG29_DANRE Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 isoform X1 OS=Danio rerio OX=7955 GN=tpip PE=3 SV=1
4	Q4V9E4	5.66e-168	488	511	0.443	0.477	Q4V9E4_DANRE Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Danio rerio OX=7955 GN=wu:fd20e11 PE=2 SV=1
5	O54857	5.99e-59	203	403	0.234	0.320	PTEN_RAT Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Rattus norvegicus OX=10116 GN=Pten PE=1 SV=1
6	O08586	1.23e-58	202	403	0.234	0.320	PTEN_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus OX=10090 GN=Pten PE=1 SV=1
7	F6KD01	1.28e-58	202	403	0.234	0.320	F6KD01_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=2 SV=1
8	P60484	1.28e-58	202	403	0.234	0.320	PTEN_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1
9	B8XSI6	1.37e-58	202	403	0.234	0.320	B8XSI6_PIG Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Sus scrofa OX=9823 GN=PTEN PE=2 SV=1
10	Q9LT75	1.96e-58	207	611	0.218	0.196	PTN2A_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A OS=Arabidopsis thaliana OX=3702 GN=PTEN2A PE=1 SV=1
11	Q6TGR7	5.47e-56	196	431	0.201	0.258	Q6TGR7_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=wu:fc52g04 PE=2 SV=1
12	Q9Y0B6	1.96e-55	194	418	0.212	0.280	Q9Y0B6_DROME PTEN1 OS=Drosophila melanogaster OX=7227 GN=Pten PE=2 SV=1
13	Q6PC66	2.78e-55	194	452	0.212	0.259	Q6PC66_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=ptena PE=2 SV=1
14	Q7ZZ56	6.72e-55	192	399	0.223	0.308	Q7ZZ56_DANRE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=fa11a08 PE=2 SV=1
15	Q54MG8	1.39e-54	201	998	0.211	0.116	Q54MG8_DICDI LIM-domain containing phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285967 PE=2 SV=2
16	Q9V3L4	1.53e-54	194	509	0.212	0.230	Q9V3L4_DROME PTEN3 OS=Drosophila melanogaster OX=7227 GN=Pten PE=2 SV=1
17	Q9U470	1.84e-54	194	506	0.212	0.231	Q9U470_DROME Phosphatase and tensin homolog OS=Drosophila melanogaster OX=7227 GN=Pten PE=2 SV=1
18	Q7KMQ6	1.85e-54	194	514	0.212	0.228	Q7KMQ6_DROME IP16020p OS=Drosophila melanogaster OX=7227 GN=Pten PE=2 SV=1
19	Q9Y0B5	1.87e-54	194	511	0.212	0.229	Q9Y0B5_DROME PTEN2 OS=Drosophila melanogaster OX=7227 GN=Pten PE=2 SV=1
20	Q8H106	3.71e-52	190	632	0.214	0.187	PTN2B_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B OS=Arabidopsis thaliana OX=3702 GN=PTEN2B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06018 CodY	16	16.5	CodY GAF-like domain
2	PF00782 DSPc	7.3e-05	34.0	Dual specificity phosphatase, catalytic domain
3	PF00520 Ion_trans	0.077	23.8	Ion transport protein
4	PF08016 PKD_channel	13	16.6	Polycystin cation channel
5	PF10409 PTEN_C2	5.9e-23	92.5	C2 domain of PTEN tumour-suppressor protein
6	PF14566 PTPlike_phytase	1e+02	14.5	Inositol hexakisphosphate
7	PF00102 Y_phosphatase	2.2	19.3	Protein-tyrosine phosphatase
8	PF13350 Y_phosphatase3	25	16.4	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484443	0.764	Serine/threonine-protein kinase Nek3
2	9606.ENSP00000384164	0.537	Kinesin-like protein KIF16B
3	9606.ENSP00000389237	0.528	Neuroblastoma breakpoint family member 4
4	9606.ENSP00000485185	0.519	Unknown. Candidate gene encoding tumor antigens
5	9606.ENSP00000373594	0.515	Transmembrane protein 266

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016791	1.000	phosphatase activity
GO:0140096	0.995	catalytic activity, acting on a protein
GO:0005515	0.995	protein binding
GO:0004721	0.974	phosphoprotein phosphatase activity
GO:0004725	0.964	protein tyrosine phosphatase activity
GO:0052866	0.926	phosphatidylinositol phosphate phosphatase activity
GO:0034593	0.610	phosphatidylinositol bisphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.996	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0006796	0.993	phosphate-containing compound metabolic process
GO:0044238	0.992	primary metabolic process
GO:0050794	0.975	regulation of cellular process
GO:0051716	0.952	cellular response to stimulus
GO:0007154	0.773	cell communication
GO:0023052	0.772	signaling
GO:0016311	0.723	dephosphorylation
GO:0006807	0.686	nitrogen compound metabolic process
GO:0043170	0.641	macromolecule metabolic process
GO:1901564	0.601	organonitrogen compound metabolic process
GO:0019538	0.529	protein metabolic process
GO:0046488	0.474	phosphatidylinositol metabolic process
GO:0007165	0.447	signal transduction
GO:0036211	0.432	protein modification process
GO:0006470	0.396	protein dephosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005622	0.963	intracellular anatomical structure
GO:0005737	0.954	cytoplasm
GO:0043227	0.834	membrane-bounded organelle
GO:0043231	0.760	intracellular membrane-bounded organelle
GO:0012505	0.595	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.964	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.964	protein-tyrosine-phosphatase.

[back to server]