StarFunc result for job id P56182

User Input

>input (461 residues)
MVSRVQLPPEIQLAQRLAGNEQVTRDRAVRKLRKYIVARTQRAAGGFTHDELLKVWKGLF
YCMWMQDKPLLQEELGRTISQLVHAFQTTEAQHLFLQAFWQTMNREWTGIDRLRLDKFYM
LMRMVLNESLKVLKMQGWEERQIEELLELLMTEILHPSSQAPNGVKSHFIEIFLEELTKV
GAEELTADQNLKFIDPFCRIAARTKDSLVLNNITRGIFETIVEQAPLAIEDLLNELDTQD
EEVASDSDESSEGGERGDALSQKRSEKPPAGSICRAEPEAGEEQAGDDRDSGGPVLQFDY
EAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACRRLLEGRRQKK
TKKQKRLLRLQQERGKGEKEPPSPGMERKRSRRRGVGADPEARAEAGEQPGTAERALLRD
QPRGRGQRGARQRRRTPRPLTSARAKAANVQEPEKKKKRRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56182	1.000	1.000	2.852E-54	461	1.000	1.000	P56182.pdb.gz	RRP1_HUMAN Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1
2	AFDB:Q14684	0.595	0.366	1.905E-28	758	0.414	0.252	Q14684.pdb.gz	RRP1B_HUMAN Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3
3	AFDB:Q57X33	0.510	0.383	2.394E-10	623	0.176	0.130	Q57X33.pdb.gz	Q57X33_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.60 PE=3 SV=1
4	PDB:6c0fz	0.355	0.656	3.855E-8	243	0.134	0.255	6c0fz.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
5	PDB:5z3gX	0.355	0.786	9.211E-7	202	0.130	0.297	5z3gX.pdb.gz	Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
6	AFDB:Q6P9Q4	0.193	0.098	2.715E-3	1197	0.154	0.059	Q6P9Q4.pdb.gz	FHOD1_MOUSE FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3
7	AFDB:E1JIQ0	0.251	0.145	3.078E-3	943	0.174	0.085	E1JIQ0.pdb.gz	E1JIQ0_DROME FI18806p1 OS=Drosophila melanogaster OX=7227 GN=unc79 PE=2 SV=1
8	AFDB:Q8C0V1	0.211	0.148	4.872E-3	768	0.117	0.070	Q8C0V1.pdb.gz	TERB1_MOUSE Telomere repeats-binding bouquet formation protein 1 OS=Mus musculus OX=10090 GN=Terb1 PE=1 SV=2
9	AFDB:Q06680	0.304	0.160	5.080E-3	1035	0.113	0.050	Q06680.pdb.gz	CND3_YEAST Condensin complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCG1 PE=1 SV=2
10	AFDB:Q10719	0.121	0.058	8.384E-3	1372	0.126	0.042	Q10719.pdb.gz	FUS1_SCHPO Cell fusion protein fus1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fus1 PE=2 SV=1
11	AFDB:Q38CA8	0.229	0.164	9.909E-3	715	0.080	0.052	Q38CA8.pdb.gz	Q38CA8_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6740 PE=4 SV=1
12	AFDB:A1Z9G2	0.117	0.078	1.171E-2	883	0.111	0.058	A1Z9G2.pdb.gz	SYF1_DROME Pre-mRNA-splicing factor syf1 homolog OS=Drosophila melanogaster OX=7227 GN=fand PE=1 SV=1
13	PDB:2q5dB	0.190	0.120	6.142E-2	845	0.093	0.051	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
14	PDB:5lqwQ	0.180	0.128	8.578E-2	791	0.078	0.046	5lqwQ.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
15	PDB:1qgkA	0.226	0.144	8.944E-2	876	0.080	0.042	1qgkA.pdb.gz
16	PDB:1b3uA	0.179	0.150	1.198E-1	588	0.089	0.070	1b3uA.pdb.gz
17	PDB:7onuE	0.171	0.170	1.539E-1	467	0.061	0.060	7onuE.pdb.gz	Structural basis of RNA processing by human mitochondrial RNase P.
18	PDB:6l4oA	0.146	0.153	1.897E-1	429	0.113	0.121	6l4oA.pdb.gz
19	PDB:1oyzA	0.107	0.153	1.977E-1	273	0.052	0.088	1oyzA.pdb.gz
20	PDB:6gx9A	0.194	0.119	1.977E-1	912	0.087	0.044	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56182	0.0	935	461	1.000	1.000	RRP1_HUMAN Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1
2	Q14684	9.94e-130	395	758	0.438	0.266	RRP1B_HUMAN Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3
3	Q91YK2	5.83e-117	361	724	0.382	0.243	RRP1B_MOUSE Ribosomal RNA processing protein 1 homolog B OS=Mus musculus OX=10090 GN=Rrp1b PE=1 SV=2
4	Q9Y7M6	1.45e-30	119	217	0.150	0.318	RRP1_SCHPO Ribosomal RNA-processing protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC9B6.07 PE=1 SV=1
5	P35178	8.94e-20	91.3	278	0.117	0.194	RRP1_YEAST Ribosomal RNA-processing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP1 PE=1 SV=2
6	Q57X33	1.73e-13	75.1	623	0.072	0.053	Q57X33_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.60 PE=3 SV=1
7	Q27GU4	0.68	34.7	348	0.039	0.052	Q27GU4_CAEEL MARVEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F41C3.8 PE=1 SV=1
8	E9PV24	2.7	33.1	789	0.080	0.047	FIBA_MOUSE Fibrinogen alpha chain OS=Mus musculus OX=10090 GN=Fga PE=1 SV=1
9	C9J8U3	5.5	31.6	303	0.059	0.089	C9J8U3_HUMAN Aprataxin OS=Homo sapiens OX=9606 GN=APTX PE=1 SV=2
10	P70541	5.5	32.0	452	0.067	0.069	EI2BG_RAT Translation initiation factor eIF-2B subunit gamma OS=Rattus norvegicus OX=10116 GN=Eif2b3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16419 CNOT1_HEAT_N	1.1e+02	13.9	CCR4-NOT transcription complex subunit 1 HEAT repeat
2	PF14500 MMS19_N	3.4e+02	12.2	Dos2-interacting transcription regulator of RNA-Pol-II
3	PF05997 Nop52	1.7e-66	235.7	Nucleolar protein,Nop52

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264279	0.992	Nucleolar protein 58
2	9606.ENSP00000455106	0.992	Ribosome biogenesis protein BOP1
3	9606.ENSP00000423067	0.989	WD repeat-containing protein 36
4	9606.ENSP00000370589	0.987	Nucleolar protein 56
5	9606.ENSP00000296792	0.986	U3 small nucleolar RNA-associated protein 15 homolog
6	9606.ENSP00000261015	0.985	Ribosome biogenesis protein WDR12
7	9606.ENSP00000221801	0.983	rRNA 2'-O-methyltransferase fibrillarin
8	9606.ENSP00000350698	0.983	Probable ATP-dependent RNA helicase DDX47
9	9606.ENSP00000358812	0.983	Protein RRP5 homolog
10	9606.ENSP00000363642	0.983	Ribosome biogenesis protein BMS1 homolog
11	9606.ENSP00000353246	0.982	Protein MAK16 homolog
12	9606.ENSP00000362105	0.982	Probable U3 small nucleolar RNA-associated protein 11
13	9606.ENSP00000259239	0.981	U3 small nucleolar ribonucleoprotein protein IMP4
14	9606.ENSP00000363746	0.981	WD repeat-containing protein 46
15	9606.ENSP00000454836	0.981	Transducin beta-like protein 3
16	9606.ENSP00000225298	0.980	U3 small nucleolar RNA-associated protein 18 homolog
17	9606.ENSP00000254803	0.980	Something about silencing protein 10
18	9606.ENSP00000328854	0.980	Nucleolar complex protein 4 homolog
19	9606.ENSP00000405068	0.980	Nucleolar protein 14
20	9606.ENSP00000479504	0.980	Probable ATP-dependent RNA helicase DDX52

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.994	regulation of biological process
GO:0019219	0.982	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.950	regulation of gene expression
GO:0051252	0.805	regulation of RNA metabolic process
GO:0048518	0.643	positive regulation of biological process
GO:0009987	0.511	cellular process
GO:0071704	0.496	organic substance metabolic process
GO:0048522	0.492	positive regulation of cellular process
GO:0031326	0.480	regulation of cellular biosynthetic process
GO:0010556	0.467	regulation of macromolecule biosynthetic process
GO:0071840	0.427	cellular component organization or biogenesis
GO:0009893	0.426	positive regulation of metabolic process
GO:0044238	0.387	primary metabolic process
GO:0050896	0.357	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005694	0.999	chromosome
GO:0005654	0.958	nucleoplasm
GO:0005737	0.498	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]