StarFunc result for job id P56192

User Input

>input (900 residues)
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTP
QQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z941	0.745	0.744	0.000	902	0.909	0.907	D3Z941.pdb.gz	D3Z941_RAT Methionine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mars1 PE=1 SV=1
2	AFDB:A1ZBE9	0.643	0.567	5.007E-86	1022	0.493	0.434	A1ZBE9.pdb.gz	A1ZBE9_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=1 SV=1
3	AFDB:Q9UUF2	0.623	0.715	7.356E-70	782	0.379	0.436	Q9UUF2.pdb.gz	SYMC_SCHPO Probable methionine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rar1 PE=3 SV=1
4	AFDB:P00958	0.621	0.742	1.911E-68	751	0.366	0.438	P00958.pdb.gz	SYMC_YEAST Methionine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MES1 PE=1 SV=4
5	AFDB:Q9SVN5	0.603	0.679	1.789E-63	797	0.349	0.394	Q9SVN5.pdb.gz	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
6	AFDB:P00959	0.569	0.747	7.888E-40	677	0.179	0.238	P00959.pdb.gz	SYM_ECOLI Methionine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=metG PE=1 SV=2
7	AFDB:Q8IJ60	0.501	0.507	2.202E-35	889	0.169	0.171	Q8IJ60.pdb.gz	Q8IJ60_PLAF7 methionine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1034900 PE=3 SV=1
8	AFDB:Q38C91	0.499	0.577	9.112E-34	773	0.186	0.216	Q38C91.pdb.gz	Q38C91_TRYB2 methionine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6470 PE=1 SV=1
9	AFDB:Q9M2T9	0.501	0.719	9.334E-33	616	0.156	0.227	Q9M2T9.pdb.gz	SYMM_ARATH Methionine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA1 PE=2 SV=1
10	AFDB:P9WFU5	0.511	0.867	6.003E-32	519	0.141	0.245	P9WFU5.pdb.gz	SYM_MYCTU Methionine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metG PE=1 SV=1
11	PDB:6ax8A	0.501	0.866	4.436E-30	509	0.140	0.248	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
12	PDB:7d5cA	0.458	0.449	2.185E-13	919	0.120	0.118	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
13	PDB:6lpfB	0.410	0.370	3.248E-12	1006	0.126	0.112	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
14	PDB:3zgzD	0.409	0.424	4.713E-12	867	0.112	0.116	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
15	PDB:4ariA	0.378	0.412	5.181E-10	821	0.109	0.119	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
16	PDB:1u0bB	0.319	0.577	2.192E-9	461	0.077	0.150	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:1li7B	0.311	0.673	6.548E-8	375	0.064	0.155	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
18	PDB:3gh6A	0.186	0.710	2.147E-6	209	0.052	0.225	3gh6A.pdb.gz	Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
19	PDB:1a0fA	0.170	0.680	3.419E-6	201	0.041	0.184	1a0fA.pdb.gz	Three-dimensional structure of Escherichia coli glutathione S-transferase complexed with glutathione sulfonate: catalytic roles of Cys10 and His106.
20	PDB:1f7uA	0.315	0.447	4.118E-6	606	0.070	0.104	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1ZBE9	0.0	828	1022	0.498	0.438	A1ZBE9_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=1 SV=1
2	D3Z941	0.0	1653	902	0.910	0.908	D3Z941_RAT Methionine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mars1 PE=1 SV=1
3	P00958	0.0	634	751	0.328	0.393	SYMC_YEAST Methionine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MES1 PE=1 SV=4
4	P56192	0.0	1861	900	1.000	1.000	SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2
5	Q68FL6	0.0	1627	902	0.897	0.895	SYMC_MOUSE Methionine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Mars1 PE=1 SV=1
6	Q8MRS4	0.0	816	1012	0.496	0.441	Q8MRS4_DROME Methionine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=MetRS PE=2 SV=1
7	Q9SVN5	0.0	668	797	0.347	0.391	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
8	Q9UUF2	0.0	657	782	0.357	0.410	SYMC_SCHPO Probable methionine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rar1 PE=3 SV=1
9	Q5UR82	3.55e-133	412	550	0.244	0.400	SYM_MIMIV Methionine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MARS PE=1 SV=1
10	P00959	1.29e-69	246	677	0.174	0.232	SYM_ECOLI Methionine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=metG PE=1 SV=2
11	Q9M2T9	3.57e-36	147	616	0.153	0.224	SYMM_ARATH Methionine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA1 PE=2 SV=1
12	Q4QCD2	3.05e-35	146	747	0.191	0.230	Q4QCD2_LEIMA methionine--tRNA ligase OS=Leishmania major OX=5664 GN=LMJF_21_0810 PE=1 SV=1
13	Q499X9	5.74e-33	137	586	0.147	0.225	SYMM_MOUSE Methionine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Mars2 PE=1 SV=2
14	P9WFU5	7.75e-31	130	519	0.157	0.272	SYM_MYCTU Methionine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metG PE=1 SV=1
15	Q96GW9	2.80e-30	129	593	0.144	0.219	SYMM_HUMAN Methionine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=MARS2 PE=1 SV=2
16	Q38C91	3.28e-27	120	773	0.147	0.171	Q38C91_TRYB2 methionine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6470 PE=1 SV=1
17	O14000	3.27e-25	113	539	0.154	0.258	SYMM_SCHPO Probable methionine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27E2.06c PE=3 SV=1
18	Q8IJ60	4.03e-23	108	889	0.140	0.142	Q8IJ60_PLAF7 methionine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1034900 PE=3 SV=1
19	Q9VFL5	1.45e-20	99.0	582	0.131	0.203	SYMM_DROME Methionine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MetRS-m PE=1 SV=2
20	A0A1D8PP08	4.20e-19	94.4	577	0.139	0.217	A0A1D8PP08_CANAL methionine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSM1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	1.5	20.3	Anticodon-binding domain of tRNA ligase
2	PF19303 Anticodon_3	2.5e-18	77.8	Anticodon binding domain of methionyl tRNA ligase
3	PF01519 DUF16	5.4e+02	12.5	Protein of unknown function DUF16
4	PF00043 GST_C	0.18	23.4	Glutathione S-transferase, C-terminal domain
5	PF13410 GST_C_2	0.1	23.9	Glutathione S-transferase, C-terminal domain
6	PF14497 GST_C_3	64	15.1	Glutathione S-transferase, C-terminal domain
7	PF18485 GST_N_5	7.7e-27	104.9	Glutathione S-transferase, N-terminal domain
8	PF03051 Peptidase_C1_2	5.5e+02	10.7	Peptidase C1-like family
9	PF00133 tRNA-synt_1	0.0045	26.9	tRNA synthetases class I (I, L, M and V)
10	PF09334 tRNA-synt_1g	4.9e-143	488.2	tRNA synthetases class I (M)
11	PF00458 WHEP-TRS	9.3e-13	59.4	WHEP-TRS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223029	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
2	9606.ENSP00000231572	0.999	Arginine--tRNA ligase, cytoplasmic
3	9606.ENSP00000264161	0.999	Aspartate--tRNA ligase, cytoplasmic
4	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
5	9606.ENSP00000325448	0.999	Lysine--tRNA ligase
6	9606.ENSP00000355890	0.999	Bifunctional glutamate/proline--tRNA ligase
7	9606.ENSP00000364794	0.999	Isoleucine--tRNA ligase, cytoplasmic
8	9606.ENSP00000369038	0.999	Eukaryotic translation elongation factor 1 epsilon-1
9	9606.ENSP00000377954	0.999	Leucine--tRNA ligase, cytoplasmic
10	9606.ENSP00000378191	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
11	9606.ENSP00000362576	0.989	Tyrosine--tRNA ligase, cytoplasmic
12	9606.ENSP00000261772	0.967	Alanine--tRNA ligase, cytoplasmic
13	9606.ENSP00000369897	0.967	Cysteine--tRNA ligase, cytoplasmic
14	9606.ENSP00000234677	0.959	Serine--tRNA ligase, cytoplasmic
15	9606.ENSP00000373918	0.955	Glycine--tRNA ligase
16	9606.ENSP00000408576	0.955	Probable leucine--tRNA ligase, mitochondrial
17	9606.ENSP00000281038	0.951	Probable asparagine--tRNA ligase, mitochondrial
18	9606.ENSP00000387710	0.951	Threonine--tRNA ligase, cytoplasmic
19	9606.ENSP00000355536	0.947	Methionine synthase
20	9606.ENSP00000359976	0.946	Cystathionine gamma-lyase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004825	0.999	methionine-tRNA ligase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0010467	0.984	gene expression
GO:0044271	0.980	cellular nitrogen compound biosynthetic process
GO:0043603	0.978	amide metabolic process
GO:0034645	0.978	cellular macromolecule biosynthetic process
GO:0006139	0.976	nucleobase-containing compound metabolic process
GO:0090304	0.972	nucleic acid metabolic process
GO:0006412	0.956	translation
GO:0016070	0.954	RNA metabolic process
GO:0006399	0.941	tRNA metabolic process
GO:0006520	0.939	amino acid metabolic process
GO:0043038	0.925	amino acid activation
GO:0006418	0.858	tRNA aminoacylation for protein translation
GO:0050789	0.571	regulation of biological process
GO:0050794	0.473	regulation of cellular process
GO:0019222	0.403	regulation of metabolic process
GO:0060255	0.357	regulation of macromolecule metabolic process
GO:0080090	0.336	regulation of primary metabolic process
GO:0051171	0.301	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:1902494	0.995	catalytic complex
GO:0017101	0.991	aminoacyl-tRNA synthetase multienzyme complex
GO:0005829	0.979	cytosol
GO:0031974	0.972	membrane-enclosed lumen
GO:0070013	0.962	intracellular organelle lumen
GO:0005634	0.948	nucleus
GO:0016020	0.943	membrane
GO:0043232	0.876	intracellular non-membrane-bounded organelle
GO:0005576	0.860	extracellular region
GO:0031981	0.823	nuclear lumen
GO:0005615	0.783	extracellular space
GO:1903561	0.750	extracellular vesicle
GO:0070062	0.732	extracellular exosome
GO:0005654	0.410	nucleoplasm
GO:0005739	0.365	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13481	0.999	ATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
EC:6.1.1.10	0.999	methionine--tRNA ligase.

[back to server]