StarFunc result for job id P56199

User Input

>input (1179 residues)
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTTDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTTENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDIS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K470	0.688	0.688	0.000	1178	0.396	0.396	A0A0G2K470.pdb.gz	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	AFDB:O75578	0.626	0.632	0.000	1167	0.353	0.356	O75578.pdb.gz	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	AFDB:P17301	0.800	0.799	0.000	1181	0.396	0.395	P17301.pdb.gz	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	AFDB:P18614	0.783	0.783	0.000	1180	0.878	0.877	P18614.pdb.gz	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	AFDB:P56199	1.000	1.000	0.000	1179	1.000	1.000	P56199.pdb.gz	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	AFDB:P61622	0.641	0.636	0.000	1188	0.389	0.386	P61622.pdb.gz	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	AFDB:Q13349	0.608	0.617	2.722E-100	1161	0.263	0.267	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
8	AFDB:Q9QYE7	0.548	0.555	5.583E-99	1161	0.264	0.268	Q9QYE7.pdb.gz	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
9	AFDB:P11215	0.540	0.550	2.738E-98	1152	0.271	0.277	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
10	AFDB:Q9QXH4	0.527	0.531	2.052E-97	1169	0.261	0.263	Q9QXH4.pdb.gz	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
11	PDB:4nehA	0.449	0.486	4.498E-89	1084	0.243	0.264	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.442	0.487	1.268E-87	1063	0.233	0.259	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:7uslA	0.411	0.556	2.828E-67	856	0.193	0.265	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:4g1eA	0.410	0.494	1.354E-65	964	0.187	0.228	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:3fcsA	0.415	0.528	3.537E-63	913	0.163	0.210	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:7nxdA	0.421	0.536	2.384E-62	905	0.179	0.233	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:3k6sC	0.406	0.531	7.474E-61	885	0.191	0.254	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
18	PDB:4rtdA	0.078	0.082	7.403E-11	1122	0.057	0.060	4rtdA.pdb.gz
19	PDB:5a42A	0.101	0.083	8.938E-10	1597	0.055	0.041	5a42A.pdb.gz
20	PDB:7sqcO0	0.120	0.123	2.447E-9	1140	0.040	0.041	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K470	0.0	823	1178	0.403	0.403	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	O75578	0.0	711	1167	0.360	0.363	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	P17301	0.0	837	1181	0.405	0.405	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	P18614	0.0	2120	1180	0.878	0.877	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	P56199	0.0	2453	1179	1.000	1.000	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	P61622	0.0	828	1188	0.394	0.391	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	Q3V3R4	0.0	2132	1179	0.880	0.880	ITA1_MOUSE Integrin alpha-1 OS=Mus musculus OX=10090 GN=Itga1 PE=1 SV=2
8	Q62469	0.0	826	1178	0.399	0.400	ITA2_MOUSE Integrin alpha-2 OS=Mus musculus OX=10090 GN=Itga2 PE=1 SV=2
9	Q9UKX5	0.0	820	1188	0.394	0.391	ITA11_HUMAN Integrin alpha-11 OS=Homo sapiens OX=9606 GN=ITGA11 PE=1 SV=2
10	P05555	4.51e-116	390	1153	0.305	0.312	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
11	P11215	2.83e-115	388	1152	0.297	0.304	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
12	Q3V0T4	2.27e-113	383	1168	0.287	0.289	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
13	Q9QYE7	3.04e-113	383	1161	0.289	0.294	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
14	A0A0G2K4L8	8.62e-113	381	1151	0.287	0.294	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
15	Q9JI30	2.13e-112	380	1151	0.286	0.293	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
16	G3V8L7	7.29e-111	376	1151	0.287	0.294	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
17	P20701	2.44e-108	369	1170	0.246	0.248	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
18	Q9QXH4	2.91e-107	366	1169	0.288	0.290	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
19	A0A8I5Y8A4	3.65e-107	365	1141	0.283	0.293	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
20	P61625	4.23e-107	366	1165	0.288	0.292	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00690 Cation_ATPase_N	5.4e+02	11.7	Cation transporter/ATPase, N-terminus
2	PF01839 FG-GAP	5.5e-19	78.9	FG-GAP repeat
3	PF14312 FG-GAP_2	0.049	25.2	FG-GAP repeat
4	PF13517 FG-GAP_3	0.0022	29.9	FG-GAP-like repeat
5	PF18698 HisK_sensor	4.7	19.0	Histidine kinase sensor domain
6	PF00357 Integrin_alpha	70	14.8	Integrin alpha cytoplasmic region
7	PF08441 Integrin_alpha2	4.7e-57	205.7	Integrin alpha
8	PF15686 LYRIC	5	18.1	Lysine-rich CEACAM1 co-isolated protein family
9	PF00092 VWA	3.8e-39	146.2	von Willebrand factor type A domain
10	PF13519 VWA_2	2e-10	52.6	von Willebrand factor type A domain
11	PF05762 VWA_CoxE	6.8e+02	11.0	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379350	0.999	Integrin beta-1
2	9606.ENSP00000311857	0.983	Tyrosine-protein phosphatase non-receptor type 2
3	9606.ENSP00000332274	0.976	Protein tyrosine phosphatase type IVA 3
4	9606.ENSP00000452786	0.968	Integrin beta-3
5	9606.ENSP00000296181	0.967	Integrin beta-5
6	9606.ENSP00000339191	0.967	Caveolin-1
7	9606.ENSP00000283249	0.963	Integrin beta-6
8	9606.ENSP00000267082	0.960	Integrin beta-7
9	9606.ENSP00000380948	0.960	Integrin beta-2
10	9606.ENSP00000222573	0.959	Integrin beta-8
11	9606.ENSP00000364979	0.955	Collagen alpha-1(IV) chain
12	9606.ENSP00000374309	0.954	Laminin subunit alpha-1
13	9606.ENSP00000316029	0.949	Talin-1
14	9606.ENSP00000297268	0.947	Collagen alpha-2(I) chain
15	9606.ENSP00000230538	0.946	Laminin subunit alpha-4
16	9606.ENSP00000252999	0.944	Laminin subunit alpha-5
17	9606.ENSP00000222399	0.940	Laminin subunit beta-1
18	9606.ENSP00000225964	0.939	Collagen alpha-1(I) chain
19	9606.ENSP00000364000	0.939	Collagen alpha-2(V) chain
20	9606.ENSP00000400365	0.939	Laminin subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0005518	1.000	collagen binding
GO:0098631	0.929	cell adhesion mediator activity
GO:0005102	0.919	signaling receptor binding
GO:0019899	0.799	enzyme binding
GO:0019903	0.575	protein phosphatase binding
GO:0098634	0.416	cell-matrix adhesion mediator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0051716	0.982	cellular response to stimulus
GO:0048518	0.980	positive regulation of biological process
GO:0007155	0.978	cell adhesion
GO:0048870	0.966	cell motility
GO:0048522	0.964	positive regulation of cellular process
GO:0048856	0.955	anatomical structure development
GO:0016477	0.955	cell migration
GO:0032501	0.941	multicellular organismal process
GO:0031589	0.877	cell-substrate adhesion
GO:0007160	0.864	cell-matrix adhesion
GO:0031323	0.797	regulation of cellular metabolic process
GO:0040011	0.791	locomotion
GO:0048583	0.777	regulation of response to stimulus
GO:0080090	0.770	regulation of primary metabolic process
GO:0010646	0.768	regulation of cell communication
GO:0051174	0.750	regulation of phosphorus metabolic process
GO:0002376	0.749	immune system process
GO:0023051	0.737	regulation of signaling
GO:0048519	0.729	negative regulation of biological process
GO:0060255	0.728	regulation of macromolecule metabolic process
GO:0050790	0.727	regulation of catalytic activity
GO:0007275	0.721	multicellular organism development
GO:0051171	0.706	regulation of nitrogen compound metabolic process
GO:0042221	0.705	response to chemical
GO:0007154	0.666	cell communication
GO:0009893	0.665	positive regulation of metabolic process
GO:0042127	0.663	regulation of cell population proliferation
GO:0048523	0.662	negative regulation of cellular process
GO:0051246	0.658	regulation of protein metabolic process
GO:0010604	0.655	positive regulation of macromolecule metabolic process
GO:0019220	0.630	regulation of phosphate metabolic process
GO:0009966	0.626	regulation of signal transduction
GO:0023052	0.623	signaling
GO:0044093	0.622	positive regulation of molecular function
GO:0070887	0.611	cellular response to chemical stimulus
GO:0071840	0.556	cellular component organization or biogenesis
GO:0007165	0.548	signal transduction
GO:0016043	0.495	cellular component organization
GO:0050900	0.428	leukocyte migration
GO:0051239	0.382	regulation of multicellular organismal process
GO:0007166	0.370	cell surface receptor signaling pathway
GO:0060326	0.367	cell chemotaxis
GO:0048584	0.355	positive regulation of response to stimulus
GO:0009653	0.346	anatomical structure morphogenesis
GO:0031325	0.331	positive regulation of cellular metabolic process
GO:0030154	0.324	cell differentiation
GO:0065008	0.319	regulation of biological quality
GO:0031399	0.301	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.998	cell surface
GO:0043227	0.998	membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0030055	0.976	cell-substrate junction
GO:0031982	0.975	vesicle
GO:0005925	0.974	focal adhesion
GO:0005576	0.972	extracellular region
GO:0043235	0.970	receptor complex
GO:0098797	0.968	plasma membrane protein complex
GO:0098636	0.967	protein complex involved in cell adhesion
GO:0098802	0.963	plasma membrane signaling receptor complex
GO:0005622	0.960	intracellular anatomical structure
GO:0005737	0.927	cytoplasm
GO:0043229	0.906	intracellular organelle
GO:0005615	0.903	extracellular space
GO:0043231	0.863	intracellular membrane-bounded organelle
GO:0065010	0.851	extracellular membrane-bounded organelle
GO:0070062	0.843	extracellular exosome
GO:0012505	0.750	endomembrane system
GO:0008305	0.716	integrin complex
GO:0098552	0.534	side of membrane
GO:0009897	0.419	external side of plasma membrane
GO:0031410	0.417	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]