StarFunc result for job id P56211

User Input

>input (112 residues)
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYF
DSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56211	1.000	1.000	8.986E-17	112	1.000	1.000	P56211.pdb.gz	ARP19_HUMAN cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19 PE=1 SV=2
2	AFDB:Q6DEB4	0.267	0.257	1.118E-11	117	0.866	0.829	Q6DEB4.pdb.gz	AR19A_XENLA cAMP-regulated phosphoprotein 19-A OS=Xenopus laevis OX=8355 GN=arpp19-a PE=1 SV=1
3	AFDB:O43768	0.334	0.311	3.418E-11	121	0.723	0.669	O43768.pdb.gz	ENSA_HUMAN Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1
4	AFDB:Q7ZXH9	0.273	0.247	9.102E-10	125	0.714	0.640	Q7ZXH9.pdb.gz	ENSA_XENLA Alpha-endosulfine OS=Xenopus laevis OX=8355 GN=ensa PE=1 SV=1
5	AFDB:Q9VUB8	0.236	0.225	2.803E-5	119	0.438	0.412	Q9VUB8.pdb.gz	Q9VUB8_DROME Endosulfine, isoform A OS=Drosophila melanogaster OX=7227 GN=endos PE=1 SV=1
6	AFDB:Q63754	0.216	0.188	2.460	137	0.125	0.102	Q63754.pdb.gz	SYUB_RAT Beta-synuclein OS=Rattus norvegicus OX=10116 GN=Sncb PE=1 SV=1
7	AFDB:Q9FY89	0.168	0.114	2.460	216	0.205	0.106	Q9FY89.pdb.gz	VP202_ARATH Vacuolar protein sorting-associated protein 20 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS20.2 PE=1 SV=1
8	AFDB:Q53ET0	0.137	0.041	2.638	693	0.205	0.033	Q53ET0.pdb.gz	CRTC2_HUMAN CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2
9	AFDB:Q8CCV7	0.194	0.150	3.740	154	0.152	0.110	Q8CCV7.pdb.gz	Q8CCV7_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Meg3 PE=2 SV=1
10	AFDB:Q92858	0.218	0.080	3.740	354	0.143	0.045	Q92858.pdb.gz	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
11	PDB:5tm0A	0.169	0.173	5.173	108	0.143	0.148	5tm0A.pdb.gz
12	PDB:7ktrE	0.224	0.208	5.173	124	0.152	0.137	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
13	PDB:6n8jb	0.215	0.053	6.379	647	0.125	0.022	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
14	PDB:6t9iF	0.124	0.124	9.699	111	0.098	0.099	6t9iF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56211	5.22e-78	226	112	1.000	1.000	ARP19_HUMAN cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19 PE=1 SV=2
2	Q712U5	3.30e-77	224	112	0.991	0.991	ARP19_RAT cAMP-regulated phosphoprotein 19 OS=Rattus norvegicus OX=10116 GN=Arpp19 PE=1 SV=3
3	Q6DEB4	8.79e-65	193	117	0.848	0.812	AR19A_XENLA cAMP-regulated phosphoprotein 19-A OS=Xenopus laevis OX=8355 GN=arpp19-a PE=1 SV=1
4	O43768	2.98e-54	167	121	0.750	0.694	ENSA_HUMAN Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1
5	Q7ZXH9	3.13e-54	167	125	0.732	0.656	ENSA_XENLA Alpha-endosulfine OS=Xenopus laevis OX=8355 GN=ensa PE=1 SV=1
6	P60841	1.78e-53	165	121	0.750	0.694	ENSA_RAT Alpha-endosulfine OS=Rattus norvegicus OX=10116 GN=Ensa PE=1 SV=1
7	Q9VUB8	7.62e-20	79.7	119	0.438	0.412	Q9VUB8_DROME Endosulfine, isoform A OS=Drosophila melanogaster OX=7227 GN=endos PE=1 SV=1
8	P79058	6.72e-08	49.7	139	0.295	0.237	IGO1_SCHPO mRNA stability protein mug134 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug134 PE=2 SV=4
9	P53897	0.009	36.2	168	0.232	0.155	IGO1_YEAST mRNA stability protein IGO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IGO1 PE=1 SV=1
10	Q9P305	0.034	34.3	131	0.179	0.153	IGO2_YEAST mRNA stability protein IGO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IGO2 PE=1 SV=3
11	Q1L5Z9	4.5	28.9	754	0.143	0.021	LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens OX=9606 GN=LONRF2 PE=1 SV=3
12	Q6FXG1	5.0	28.9	2124	0.268	0.014	Q6FXG1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CCH1 PE=4 SV=1
13	Q5TB80	5.2	28.5	1403	0.107	0.009	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
14	Q9V3N8	6.9	28.1	286	0.098	0.038	THG1_DROME Probable tRNA(His) guanylyltransferase OS=Drosophila melanogaster OX=7227 GN=THG PE=1 SV=1
15	O60162	9.1	27.7	598	0.143	0.027	YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19F5.03 PE=1 SV=1
16	P51541	9.2	27.7	357	0.116	0.036	KARG_LIMPO Arginine kinase OS=Limulus polyphemus OX=6850 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04667 Endosulfine	3.5e-06	38.4	cAMP-regulated phosphoprotein/endosulfine conserved region
2	PF15532 Ntox30	70	15.1	Bacterial toxin 30

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000007355

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002522	0.855	Microtubule associated serine/threonine kinase-like
2	9601.ENSPPYP00000003235	0.786	Protein phosphatase 2, regulatory subunit B, delta
3	9601.ENSPPYP00000010902	0.702	Microtubule associated serine/threonine kinase 3
4	9601.ENSPPYP00000020683	0.661	Protein phosphatase 2, regulatory subunit B, alpha
5	9601.ENSPPYP00000017801	0.607	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
6	9601.ENSPPYP00000016297	0.605	Protein phosphatase 2, regulatory subunit B, gamma
7	9601.ENSPPYP00000004999	0.600	Belongs to the protein kinase superfamily.
8	9601.ENSPPYP00000018509	0.600	Serine/threonine-protein kinase 38
9	9601.ENSPPYP00000020727	0.585	Protein phosphatase 2, catalytic subunit, beta isozyme
10	9601.ENSPPYP00000021405	0.578	Stomatin (EPB72)-like 2
11	9601.ENSPPYP00000022584	0.571	Uncharacterized protein
12	9601.ENSPPYP00000002808	0.568	Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset
13	9601.ENSPPYP00000019936	0.554	Glucocorticoid induced transcript 1
14	9601.ENSPPYP00000008675	0.540	Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process (By similarity)
15	9601.ENSPPYP00000003078	0.534	Survival of motor neuron-related-splicing factor 30
16	9601.ENSPPYP00000001628	0.527	Microtubule associated serine/threonine kinase 2
17	9601.ENSPPYP00000010774	0.527	Microtubule associated serine/threonine kinase 1
18	9601.ENSPPYP00000017338	0.527	Uncharacterized protein
19	9601.ENSPPYP00000017339	0.527	Microtubule associated serine/threonine kinase family member 4
20	9601.ENSPPYP00000015689	0.523	May act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0015459	1.000	potassium channel regulator activity
GO:0140678	0.690	molecular function inhibitor activity
GO:0030234	0.364	enzyme regulator activity
GO:0004857	0.324	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.941	response to stimulus
GO:0044772	0.908	mitotic cell cycle phase transition
GO:0048522	0.886	positive regulation of cellular process
GO:0019222	0.877	regulation of metabolic process
GO:0000086	0.875	G2/M transition of mitotic cell cycle
GO:0080090	0.788	regulation of primary metabolic process
GO:0031323	0.784	regulation of cellular metabolic process
GO:0051716	0.761	cellular response to stimulus
GO:0071867	0.613	response to monoamine
GO:1901700	0.570	response to oxygen-containing compound
GO:0010646	0.570	regulation of cell communication
GO:0023051	0.564	regulation of signaling
GO:0007154	0.478	cell communication
GO:0009889	0.476	regulation of biosynthetic process
GO:0023052	0.470	signaling
GO:0009893	0.470	positive regulation of metabolic process
GO:0071869	0.437	response to catecholamine
GO:0007165	0.418	signal transduction
GO:0048583	0.417	regulation of response to stimulus
GO:0009966	0.409	regulation of signal transduction
GO:0006109	0.407	regulation of carbohydrate metabolic process
GO:0062012	0.405	regulation of small molecule metabolic process
GO:0010675	0.357	regulation of cellular carbohydrate metabolic process
GO:0070887	0.338	cellular response to chemical stimulus
GO:0009719	0.329	response to endogenous stimulus
GO:0043255	0.307	regulation of carbohydrate biosynthetic process
GO:0010906	0.307	regulation of glucose metabolic process
GO:0045913	0.306	positive regulation of carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.961	cytoplasm
GO:0005829	0.465	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]