StarFunc result for job id P56278

User Input

>input (107 residues)
MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56278	1.000	1.000	4.540E-20	107	1.000	1.000	P56278.pdb.gz	MTCP1_HUMAN Protein p13 MTCP-1 OS=Homo sapiens OX=9606 GN=MTCP1 PE=1 SV=1
2	PDB:1qttA	0.874	0.805	3.997E-17	117	1.000	0.915	1qttA.pdb.gz
3	AFDB:P56280	0.888	0.822	5.874E-12	116	0.393	0.362	P56280.pdb.gz	TCL1A_MOUSE T-cell leukemia/lymphoma protein 1A OS=Mus musculus OX=10090 GN=Tcl1a PE=1 SV=1
4	AFDB:A0A024R6G5	0.899	0.847	4.936E-11	114	0.393	0.368	A0A024R6G5.pdb.gz
5	PDB:1jsgA	0.877	0.848	1.063E-10	111	0.393	0.378	1jsgA.pdb.gz
6	PDB:1jnpA	0.830	0.875	5.835E-10	101	0.364	0.386	1jnpA.pdb.gz
7	AFDB:O95988	0.780	0.657	1.720E-8	128	0.346	0.289	O95988.pdb.gz	TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens OX=9606 GN=TCL1B PE=1 SV=1
8	PDB:4zjaA	0.166	0.167	6.102E-2	106	0.112	0.113	4zjaA.pdb.gz
9	AFDB:Q6P9A2	0.236	0.070	2.511E-1	607	0.131	0.023	Q6P9A2.pdb.gz	GLT18_HUMAN Polypeptide N-acetylgalactosaminyltransferase 18 OS=Homo sapiens OX=9606 GN=GALNT18 PE=1 SV=2
10	AFDB:Q05754	0.314	0.084	2.648E-1	620	0.150	0.026	Q05754.pdb.gz	DOPO_RAT Dopamine beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Dbh PE=1 SV=1
11	AFDB:Q3J125	0.309	0.057	2.648E-1	788	0.121	0.016	Q3J125.pdb.gz	Q3J125_CERS4 Cellulose synthase catalytic subunit [UDP-forming] OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=RSP_0333 PE=1 SV=1
12	AFDB:O13958	0.321	0.116	2.793E-1	369	0.084	0.024	O13958.pdb.gz	SSN3_SCHPO Serine/threonine-protein kinase srb10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srb10 PE=1 SV=2
13	AFDB:A0A024QZJ8	0.329	0.174	2.946E-1	240	0.159	0.071	A0A024QZJ8.pdb.gz
14	AFDB:O70469	0.204	0.072	2.946E-1	412	0.178	0.046	O70469.pdb.gz	DOK2_MOUSE Docking protein 2 OS=Mus musculus OX=10090 GN=Dok2 PE=1 SV=1
15	PDB:1j1bB	0.184	0.088	3.012E-1	364	0.121	0.036	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
16	PDB:3w1zB	0.181	0.143	5.703E-1	143	0.103	0.077	3w1zB.pdb.gz
17	PDB:6s9wA	0.276	0.099	6.344E-1	411	0.084	0.022	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:7ry5BBB	0.269	0.219	6.344E-1	143	0.131	0.098	7ry5BBB.pdb.gz	Development of an Enzyme-Inhibitor Reaction Using Cellular Retinoic Acid Binding Protein II for One-Pot Megamolecule Assembly.
19	PDB:2lb6A	0.190	0.131	6.691E-1	176	0.093	0.057	2lb6A.pdb.gz
20	PDB:4binA	0.248	0.105	7.056E-1	348	0.131	0.040	4binA.pdb.gz	The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56278	5.47e-75	218	107	1.000	1.000	MTCP1_HUMAN Protein p13 MTCP-1 OS=Homo sapiens OX=9606 GN=MTCP1 PE=1 SV=1
2	Q60945	5.05e-72	211	107	0.944	0.944	MTCP1_MOUSE Protein p13 MTCP-1 OS=Mus musculus OX=10090 GN=Mtcp1 PE=2 SV=1
3	P56280	5.88e-23	87.4	116	0.374	0.345	TCL1A_MOUSE T-cell leukemia/lymphoma protein 1A OS=Mus musculus OX=10090 GN=Tcl1a PE=1 SV=1
4	P56279	4.98e-19	77.4	114	0.393	0.368	TCL1A_HUMAN T-cell leukemia/lymphoma protein 1A OS=Homo sapiens OX=9606 GN=TCL1A PE=1 SV=1
5	O95988	1.48e-13	63.9	128	0.383	0.320	TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens OX=9606 GN=TCL1B PE=1 SV=1
6	D4ABX8	1.4	30.0	636	0.262	0.044	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
7	Q80XU8	1.4	30.0	636	0.262	0.044	LRFN4_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrfn4 PE=1 SV=1
8	F4K5N0	4.4	28.5	193	0.131	0.073	F4K5N0_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At5g20790 PE=4 SV=1
9	Q9UH99	4.5	28.5	717	0.215	0.032	SUN2_HUMAN SUN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUN2 PE=1 SV=3
10	B4E2A6	4.9	28.5	752	0.215	0.031	B4E2A6_HUMAN cDNA FLJ55508, highly similar to Sad1/unc-84-like protein 2 OS=Homo sapiens OX=9606 PE=2 SV=1
11	Q93V84	6.9	28.1	331	0.168	0.054	FLXL1_ARATH Protein FLX-like 1 OS=Arabidopsis thaliana OX=3702 GN=FLXL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01840 TCL1_MTCP1	7.4e-25	98.3	TCL1/MTCP1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017580

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019838	0.863	V-akt murine thymoma viral oncogene homolog 1
2	61853.ENSNLEP00000004803	0.841	V-akt murine thymoma viral oncogene homolog 3
3	61853.ENSNLEP00000000583	0.808	T-cell leukemia/lymphoma 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0043539	1.000	protein serine/threonine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0071900	0.979	regulation of protein serine/threonine kinase activity
GO:0033138	0.976	positive regulation of peptidyl-serine phosphorylation
GO:0071902	0.968	positive regulation of protein serine/threonine kinase activity
GO:0009987	0.409	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0032991	0.996	protein-containing complex
GO:0070013	0.923	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]