StarFunc result for job id P56279

User Input

>input (114 residues)
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6G5	0.946	0.946	4.082E-20	114	1.000	1.000	A0A024R6G5.pdb.gz
2	PDB:1jsgA	0.918	0.942	1.782E-18	111	0.974	1.000	1jsgA.pdb.gz
3	AFDB:P56280	0.854	0.840	2.820E-12	116	0.526	0.517	P56280.pdb.gz	TCL1A_MOUSE T-cell leukemia/lymphoma protein 1A OS=Mus musculus OX=10090 GN=Tcl1a PE=1 SV=1
4	PDB:1jnpA	0.844	0.950	3.365E-12	101	0.491	0.554	1jnpA.pdb.gz
5	AFDB:P56278	0.847	0.899	1.147E-10	107	0.368	0.393	P56278.pdb.gz	MTCP1_HUMAN Protein p13 MTCP-1 OS=Homo sapiens OX=9606 GN=MTCP1 PE=1 SV=1
6	PDB:1qttA	0.758	0.741	1.783E-10	117	0.368	0.359	1qttA.pdb.gz
7	AFDB:O95988	0.746	0.667	5.323E-8	128	0.307	0.273	O95988.pdb.gz	TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens OX=9606 GN=TCL1B PE=1 SV=1
8	PDB:3saoA	0.168	0.133	2.517E-1	150	0.079	0.060	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
9	PDB:4binA	0.225	0.108	2.654E-1	348	0.132	0.043	4binA.pdb.gz	The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
10	PDB:5a60A	0.160	0.063	3.111E-1	429	0.228	0.061	5a60A.pdb.gz	Structural Determinants for Substrate Binding and Catalysis in Triphosphate Tunnel Metalloenzymes.
11	PDB:2l9cA	0.214	0.149	3.280E-1	176	0.149	0.097	2l9cA.pdb.gz
12	PDB:4gh7A	0.169	0.135	3.280E-1	174	0.140	0.092	4gh7A.pdb.gz
13	PDB:2kt4B	0.176	0.145	4.054E-1	157	0.140	0.102	2kt4B.pdb.gz	The v-myc-induced Q83 lipocalin is a siderocalin.
14	AFDB:Q8SXR1	0.180	0.106	4.425E-1	224	0.105	0.054	Q8SXR1.pdb.gz	Q8SXR1_DROME Neural lazarillo, isoform A OS=Drosophila melanogaster OX=7227 GN=NLaz PE=1 SV=1
15	AFDB:Q9N2L7	0.250	0.061	4.666E-1	632	0.140	0.025	Q9N2L7.pdb.gz	PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans OX=6239 GN=plk-2 PE=1 SV=1
16	AFDB:Q9NPH6	0.209	0.149	4.919E-1	170	0.079	0.053	Q9NPH6.pdb.gz	OBP2B_HUMAN Odorant-binding protein 2b OS=Homo sapiens OX=9606 GN=OBP2B PE=2 SV=1
17	PDB:7vgrA	0.210	0.139	5.282E-1	198	0.105	0.061	7vgrA.pdb.gz
18	AFDB:Q80X41	0.214	0.076	5.469E-1	440	0.114	0.030	Q80X41.pdb.gz	VRK1_MOUSE Serine/threonine-protein kinase VRK1 OS=Mus musculus OX=10090 GN=Vrk1 PE=1 SV=2
19	AFDB:Q9LNW0	0.170	0.134	5.469E-1	157	0.114	0.083	Q9LNW0.pdb.gz	HS178_ARATH 17.8 kDa class I heat shock protein OS=Arabidopsis thaliana OX=3702 GN=HSP17.8 PE=1 SV=1
20	AFDB:Q7KV88	0.147	0.038	6.410E-1	1102	0.167	0.017	Q7KV88.pdb.gz	Q7KV88_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56279	1.09e-79	231	114	1.000	1.000	TCL1A_HUMAN T-cell leukemia/lymphoma protein 1A OS=Homo sapiens OX=9606 GN=TCL1A PE=1 SV=1
2	P56280	1.21e-36	122	116	0.500	0.491	TCL1A_MOUSE T-cell leukemia/lymphoma protein 1A OS=Mus musculus OX=10090 GN=Tcl1a PE=1 SV=1
3	P56278	4.58e-21	82.8	107	0.377	0.402	MTCP1_HUMAN Protein p13 MTCP-1 OS=Homo sapiens OX=9606 GN=MTCP1 PE=1 SV=1
4	Q60945	1.21e-20	81.6	107	0.377	0.402	MTCP1_MOUSE Protein p13 MTCP-1 OS=Mus musculus OX=10090 GN=Mtcp1 PE=2 SV=1
5	O95988	3.89e-10	55.1	128	0.289	0.258	TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens OX=9606 GN=TCL1B PE=1 SV=1
6	P0AES0	0.55	31.6	619	0.184	0.034	GSP_ECOLI Bifunctional glutathionylspermidine synthetase/amidase OS=Escherichia coli (strain K12) OX=83333 GN=gss PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01840 TCL1_MTCP1	3.9e-36	134.6	TCL1/MTCP1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.998	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000375892	0.930	RAC-beta serine/threonine-protein kinase
3	9606.ENSP00000263253	0.922	Histone acetyltransferase p300
4	9606.ENSP00000263826	0.912	RAC-gamma serine/threonine-protein kinase
5	9606.ENSP00000278616	0.903	Serine-protein kinase ATM
6	9606.ENSP00000264709	0.852	DNA (cytosine-5)-methyltransferase 3A
7	9606.ENSP00000343223	0.845	T-cell leukemia/lymphoma protein 1B
8	9606.ENSP00000358488	0.813	Protein p13 MTCP-1
9	9606.ENSP00000360266	0.758	Transcription factor AP-1
10	9606.ENSP00000437940	0.737	B-lymphocyte antigen CD19
11	9606.ENSP00000400646	0.705	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
12	9606.ENSP00000422488	0.686	Steroid hormone receptor ERR2
13	9606.ENSP00000338533	0.681	Tetratricopeptide repeat domain containing
14	9606.ENSP00000342681	0.669	T-cell surface glycoprotein CD5
15	9606.ENSP00000478289	0.630	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
16	9606.ENSP00000229307	0.606	Homeobox protein NANOG
17	9606.ENSP00000221972	0.586	B-cell antigen receptor complex-associated protein alpha chain
18	9606.ENSP00000257566	0.586	T-box transcription factor TBX3
19	9606.ENSP00000433277	0.586	B-lymphocyte antigen CD20
20	9606.ENSP00000306245	0.575	Proto-oncogene c-Fos

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019901	1.000	protein kinase binding
GO:0043539	1.000	protein serine/threonine kinase activator activity
GO:0003824	0.321	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.986	regulation of metabolic process
GO:0048522	0.985	positive regulation of cellular process
GO:0009987	0.983	cellular process
GO:0010604	0.979	positive regulation of macromolecule metabolic process
GO:0033135	0.976	regulation of peptidyl-serine phosphorylation
GO:0050896	0.974	response to stimulus
GO:0031325	0.972	positive regulation of cellular metabolic process
GO:0065009	0.968	regulation of molecular function
GO:0051716	0.964	cellular response to stimulus
GO:0048519	0.954	negative regulation of biological process
GO:0051173	0.953	positive regulation of nitrogen compound metabolic process
GO:0044093	0.935	positive regulation of molecular function
GO:0050790	0.927	regulation of catalytic activity
GO:0045859	0.860	regulation of protein kinase activity
GO:0043085	0.844	positive regulation of catalytic activity
GO:0051247	0.837	positive regulation of protein metabolic process
GO:0010941	0.831	regulation of cell death
GO:0051347	0.785	positive regulation of transferase activity
GO:0033674	0.775	positive regulation of kinase activity
GO:0031401	0.731	positive regulation of protein modification process
GO:0001934	0.724	positive regulation of protein phosphorylation
GO:0045860	0.711	positive regulation of protein kinase activity
GO:0048523	0.695	negative regulation of cellular process
GO:0042221	0.678	response to chemical
GO:0008284	0.662	positive regulation of cell population proliferation
GO:0071900	0.661	regulation of protein serine/threonine kinase activity
GO:0042981	0.617	regulation of apoptotic process
GO:0065008	0.558	regulation of biological quality
GO:0070887	0.510	cellular response to chemical stimulus
GO:0010033	0.483	response to organic substance
GO:0051128	0.396	regulation of cellular component organization
GO:0071310	0.394	cellular response to organic substance
GO:0034097	0.385	response to cytokine
GO:0043066	0.378	negative regulation of apoptotic process
GO:0033138	0.371	positive regulation of peptidyl-serine phosphorylation
GO:0010468	0.370	regulation of gene expression
GO:0043254	0.370	regulation of protein-containing complex assembly
GO:0071345	0.369	cellular response to cytokine stimulus
GO:0071902	0.364	positive regulation of protein serine/threonine kinase activity
GO:0042391	0.353	regulation of membrane potential
GO:0051130	0.343	positive regulation of cellular component organization
GO:0051881	0.318	regulation of mitochondrial membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0012505	0.996	endomembrane system
GO:0005783	0.991	endoplasmic reticulum
GO:0032991	0.965	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]