StarFunc result for job id P56381

User Input

>input (51 residues)
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VTU8	0.996	0.996	4.573E-7	51	0.922	0.922	Q5VTU8.pdb.gz	AT5EL_HUMAN ATP synthase subunit epsilon-like protein, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1EP2 PE=1 SV=1
2	AFDB:P56382	0.986	0.967	6.417E-7	52	0.902	0.885	P56382.pdb.gz	ATP5E_MOUSE ATP synthase subunit epsilon, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1e PE=1 SV=2
3	PDB:1e79I	0.838	0.901	6.582E-5	47	0.863	0.936	1e79I.pdb.gz	The Structure of the Central Stalk in Bovine F(1)-ATPase at 2.4 A Resolution.
4	AFDB:Q9VXN2	0.858	0.726	1.108E-3	61	0.431	0.361	Q9VXN2.pdb.gz	SUN_DROME Protein stunted OS=Drosophila melanogaster OX=7227 GN=sun PE=1 SV=1
5	PDB:1h8eI	0.657	0.895	2.927E-3	36	0.667	0.944	1h8eI.pdb.gz	Structure of Bovine Mitochondrial F1-ATPase with Nucleotide Bound to All Three Catalytic Sites: Implications for the Mechanism of Rotary Catalysis
6	AFDB:Q96253	0.852	0.638	2.503E-2	70	0.392	0.286	Q96253.pdb.gz	ATP5E_ARATH ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g51650 PE=1 SV=3
7	AFDB:P21306	0.833	0.700	4.304E-2	62	0.333	0.274	P21306.pdb.gz	ATP5E_YEAST ATP synthase subunit epsilon, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP15 PE=1 SV=2
8	AFDB:Q38B96	0.639	0.445	1.911E-1	75	0.216	0.147	Q38B96.pdb.gz	Q38B96_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2155 PE=1 SV=1
9	AFDB:P87316	0.681	0.526	3.764E-1	67	0.275	0.209	P87316.pdb.gz	ATP5E_SCHPO Putative ATP synthase subunit epsilon, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp15 PE=3 SV=1
10	AFDB:Q920H1	0.452	0.274	4.033	91	0.137	0.077	Q920H1.pdb.gz	SG3A2_MOUSE Secretoglobin family 3A member 2 OS=Mus musculus OX=10090 GN=Scgb3a2 PE=1 SV=2
11	AFDB:Q96PL1	0.422	0.252	5.660	93	0.098	0.054	Q96PL1.pdb.gz	SG3A2_HUMAN Secretoglobin family 3A member 2 OS=Homo sapiens OX=9606 GN=SCGB3A2 PE=1 SV=1
12	AFDB:A4IJ58	0.376	0.031	6.936	831	0.157	0.010	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
13	PDB:6py8B	0.312	0.202	7.591	95	0.098	0.053	6py8B.pdb.gz	Extension of the Notch intracellular domain ankyrin repeat stack by NRARP promotes feedback inhibition of Notch signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56381	3.13e-31	103	51	1.000	1.000	ATP5E_HUMAN ATP synthase subunit epsilon, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1E PE=1 SV=2
2	P05632	3.81e-29	99.0	51	0.941	0.941	ATP5E_BOVIN ATP synthase subunit epsilon, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1E PE=1 SV=4
3	P29418	1.57e-28	97.1	51	0.882	0.882	ATP5E_RAT ATP synthase subunit epsilon, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1e PE=1 SV=2
4	Q5VTU8	2.12e-28	97.1	51	0.922	0.922	AT5EL_HUMAN ATP synthase subunit epsilon-like protein, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1EP2 PE=1 SV=1
5	P56382	2.29e-28	96.7	52	0.902	0.885	ATP5E_MOUSE ATP synthase subunit epsilon, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1e PE=1 SV=2
6	Q9VXN2	3.18e-08	46.2	61	0.392	0.328	SUN_DROME Protein stunted OS=Drosophila melanogaster OX=7227 GN=sun PE=1 SV=1
7	Q96253	1.04e-07	45.1	70	0.373	0.271	ATP5E_ARATH ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g51650 PE=1 SV=3
8	P34539	1.04e-04	37.4	54	0.431	0.407	ATP5E_CAEEL Putative ATP synthase subunit epsilon, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=R05D3.6 PE=3 SV=1
9	P21306	1.51e-04	37.0	62	0.275	0.226	ATP5E_YEAST ATP synthase subunit epsilon, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP15 PE=1 SV=2
10	P87316	0.012	32.3	67	0.353	0.269	ATP5E_SCHPO Putative ATP synthase subunit epsilon, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp15 PE=3 SV=1
11	Q38B96	0.083	30.4	75	0.216	0.147	Q38B96_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2155 PE=1 SV=1
12	Q9C4Z6	1.2	27.7	326	0.333	0.052	GPLPB_ARATH Small ribosomal subunit protein RACK1y OS=Arabidopsis thaliana OX=3702 GN=RACK1B PE=1 SV=1
13	P43586	7.5	25.8	204	0.294	0.074	LOC1_YEAST 60S ribosomal subunit assembly/export protein LOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LOC1 PE=1 SV=1
14	Q0JJ05	9.8	25.4	987	0.235	0.012	NMCPB_ORYSJ Nuclear matrix constituent protein 1b OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04627 ATP-synt_Eps	1.3e-17	74.9	Mitochondrial ATP synthase epsilon chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
3	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
4	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
5	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
6	9606.ENSP00000358840	0.999	Up-regulated during skeletal muscle growth protein 5
7	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
8	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
9	9606.ENSP00000262030	0.998	ATP synthase subunit beta, mitochondrial
10	9606.ENSP00000358737	0.998	ATP synthase F(0) complex subunit B1, mitochondrial
11	9606.ENSP00000290299	0.997	ATP synthase subunit O, mitochondrial
12	9606.ENSP00000300688	0.997	ATP synthase subunit g, mitochondrial
13	9606.ENSP00000377033	0.992	ATP synthase F(0) complex subunit C1, mitochondrial
14	9606.ENSP00000354632	0.991	ATP synthase subunit a
15	9606.ENSP00000355265	0.991	ATP synthase protein 8
16	9606.ENSP00000425759	0.989	Cytochrome c oxidase subunit 7C, mitochondrial
17	9606.ENSP00000359098	0.987	Cytochrome c oxidase subunit 7A2, mitochondrial
18	9606.ENSP00000252102	0.985	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
19	9606.ENSP00000367939	0.982	Cytochrome b-c1 complex subunit 8
20	9606.ENSP00000428895	0.979	Cytochrome c oxidase subunit 6C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016874	0.999	ligase activity
GO:0015252	0.999	proton channel activity
GO:0005515	0.998	protein binding
GO:0046933	0.961	proton-transporting ATP synthase activity, rotational mechanism
GO:0017111	0.703	ribonucleoside triphosphate phosphatase activity
GO:0140657	0.657	ATP-dependent activity
GO:0016887	0.647	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044271	0.986	cellular nitrogen compound biosynthetic process
GO:1901566	0.985	organonitrogen compound biosynthetic process
GO:0044238	0.983	primary metabolic process
GO:0009060	0.982	aerobic respiration
GO:0006119	0.973	oxidative phosphorylation
GO:0015986	0.965	proton motive force-driven ATP synthesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0098800	0.998	inner mitochondrial membrane protein complex
GO:0070013	0.992	intracellular organelle lumen
GO:1904949	0.976	ATPase complex
GO:0016469	0.972	proton-transporting two-sector ATPase complex
GO:0045259	0.955	proton-transporting ATP synthase complex
GO:0005753	0.953	mitochondrial proton-transporting ATP synthase complex
GO:0033178	0.892	proton-transporting two-sector ATPase complex, catalytic domain
GO:0045261	0.864	proton-transporting ATP synthase complex, catalytic core F(1)
GO:0000275	0.838	mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1)
GO:0031981	0.323	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.999	Ligases.
RHEA:57720	0.961	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.961	H(+)-transporting two-sector ATPase.
RHEA:23680	0.703	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.703	nucleoside-triphosphate phosphatase.
RHEA:13065	0.647	ATP + H2O = ADP + H(+) + phosphate

[back to server]