StarFunc result for job id P56385

User Input

>input (69 residues)
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARE
LAEDDSILK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56385	1.000	1.000	2.096E-9	69	1.000	1.000	P56385.pdb.gz	ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2
2	AFDB:Q00361	0.836	0.816	5.442E-8	71	0.884	0.859	Q00361.pdb.gz	ATP5I_BOVIN ATP synthase subunit e, mitochondrial OS=Bos taurus OX=9913 GN=ATP5ME PE=1 SV=2
3	AFDB:P29419	0.917	0.892	1.364E-7	71	0.855	0.831	P29419.pdb.gz	ATP5I_RAT ATP synthase subunit e, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5me PE=1 SV=3
4	AFDB:Q9YH14	0.927	0.902	7.244E-7	71	0.754	0.732	Q9YH14.pdb.gz	Q9YH14_CHICK ATP synthase subunit e, mitochondrial OS=Gallus gallus OX=9031 GN=rbf PE=1 SV=1
5	AFDB:A2ARG7	0.921	0.897	5.843E-6	71	0.667	0.648	A2ARG7.pdb.gz
6	AFDB:A0A2R8RU75	0.896	0.627	9.191E-5	102	0.623	0.422	A0A2R8RU75.pdb.gz
7	PDB:6faik	0.403	0.048	2.732	670	0.101	0.010	6faik.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
8	AFDB:B9VMQ4	0.444	0.054	4.381	809	0.188	0.016	B9VMQ4.pdb.gz	B9VMQ4_APIME Neuroligin 1 OS=Apis mellifera OX=7460 PE=2 SV=1
9	AFDB:Q3E9T2	0.417	0.088	4.763	487	0.174	0.025	Q3E9T2.pdb.gz	REM2_ARATH B3 domain-containing protein REM2 OS=Arabidopsis thaliana OX=3702 GN=REM2 PE=2 SV=2
10	AFDB:Q9P7H6	0.374	0.106	4.763	355	0.188	0.037	Q9P7H6.pdb.gz	YLK3_SCHPO Uncharacterized protein C1782.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1782.03 PE=1 SV=1
11	PDB:7qsmZ	0.444	0.236	5.328	142	0.087	0.042	7qsmZ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	AFDB:Q38A02	0.398	0.072	5.628	408	0.217	0.037	Q38A02.pdb.gz	Q38A02_TRYB2 Proteasome regulatory ATPase subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0580 PE=3 SV=1
13	PDB:7o37i	0.458	0.442	6.844	72	0.145	0.139	7o37i.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
14	PDB:7mqaSI	0.395	0.050	7.440	803	0.159	0.014	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:3o6qD	0.305	0.466	8.792	44	0.101	0.159	3o6qD.pdb.gz
16	PDB:5ko8B	0.227	0.082	8.792	218	0.058	0.018	5ko8B.pdb.gz	Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase.
17	PDB:5xtcd	0.354	0.163	9.558	171	0.101	0.041	5xtcd.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
18	PDB:5z62I	0.327	0.314	9.558	73	0.130	0.123	5z62I.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
19	PDB:6fvtN	0.260	0.035	9.558	922	0.029	0.002	6fvtN.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
20	PDB:6xkwp	0.306	0.092	9.558	254	0.072	0.020	6xkwp.pdb.gz	Cryo-EM structures of engineered active bc 1 -cbb 3 type CIII 2 CIV super-complexes and electronic communication between the complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56385	7.06e-44	137	69	1.000	1.000	ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2
2	Q00361	8.61e-27	94.4	71	0.884	0.859	ATP5I_BOVIN ATP synthase subunit e, mitochondrial OS=Bos taurus OX=9913 GN=ATP5ME PE=1 SV=2
3	Q06185	3.29e-25	90.1	71	0.870	0.845	ATP5I_MOUSE ATP synthase subunit e, mitochondrial OS=Mus musculus OX=10090 GN=Atp5me PE=1 SV=2
4	P29419	8.84e-24	86.7	71	0.855	0.831	ATP5I_RAT ATP synthase subunit e, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5me PE=1 SV=3
5	Q9YH14	5.45e-16	67.0	71	0.754	0.732	Q9YH14_CHICK ATP synthase subunit e, mitochondrial OS=Gallus gallus OX=9031 GN=rbf PE=1 SV=1
6	Q08C42	1.35e-14	63.5	71	0.652	0.634	Q08C42_DANRE ATP synthase subunit e, mitochondrial OS=Danio rerio OX=7955 GN=atp5i PE=1 SV=1
7	Q7LZ14	1.11e-10	52.8	37	0.348	0.649	Q7LZ14_CHICK ATP synthase subunit e, mitochondrial (Fragment) OS=Gallus gallus OX=9031 PE=3 SV=1
8	P33332	0.23	30.8	1336	0.232	0.012	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
9	O75747	0.64	29.6	1445	0.275	0.013	P3C2G_HUMAN Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens OX=9606 GN=PIK3C2G PE=1 SV=3
10	Q57W34	0.67	29.6	801	0.232	0.020	Q57W34_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.510 PE=3 SV=1
11	Q57W35	0.67	29.6	821	0.232	0.019	Q57W35_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.500 PE=3 SV=1
12	Q57W36	0.67	29.6	821	0.232	0.019	Q57W36_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.490 PE=3 SV=1
13	Q2RBR1	1.5	28.5	921	0.290	0.022	PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica OX=39947 GN=PHOT1B PE=1 SV=2
14	Q2QYY8	2.1	28.1	921	0.203	0.015	PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica OX=39947 GN=PHOT1A PE=1 SV=2
15	F1MAA7	2.9	27.7	1607	0.159	0.007	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
16	P02468	3.2	27.7	1607	0.159	0.007	LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus OX=10090 GN=Lamc1 PE=1 SV=2
17	Q20646	3.4	27.7	644	0.188	0.020	CEP1_CAEEL Transcription factor cep-1 OS=Caenorhabditis elegans OX=6239 GN=cep-1 PE=1 SV=2
18	Q06556	3.5	27.7	1091	0.203	0.013	Q06556_STRDY Fibronectin binding protein OS=Streptococcus dysgalactiae OX=1334 GN=fnbA PE=4 SV=1
19	Q385B3	3.5	27.3	404	0.203	0.035	Q385B3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4410 PE=4 SV=1
20	Q5VTB9	3.7	27.3	566	0.232	0.028	RN220_HUMAN E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05680 ATP-synt_E	1.6e-14	65.4	ATP synthase E chain
2	PF06295 DUF1043	2.3e+02	13.2	Protein of unknown function (DUF1043)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306003

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000243997	0.999	ATP synthase subunit epsilon, mitochondrial
3	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
4	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
5	9606.ENSP00000300688	0.999	ATP synthase subunit g, mitochondrial
6	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
7	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
8	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
9	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
10	9606.ENSP00000262030	0.998	ATP synthase subunit beta, mitochondrial
11	9606.ENSP00000349142	0.998	ATP synthase subunit gamma, mitochondrial
12	9606.ENSP00000354632	0.991	ATP synthase subunit a
13	9606.ENSP00000358840	0.991	Up-regulated during skeletal muscle growth protein 5
14	9606.ENSP00000355265	0.990	ATP synthase protein 8
15	9606.ENSP00000377033	0.990	ATP synthase F(0) complex subunit C1, mitochondrial
16	9606.ENSP00000418842	0.990	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
17	9606.ENSP00000284727	0.987	ATP synthase F(0) complex subunit C3, mitochondrial
18	9606.ENSP00000367939	0.987	Cytochrome b-c1 complex subunit 8
19	9606.ENSP00000425759	0.983	Cytochrome c oxidase subunit 7C, mitochondrial
20	9606.ENSP00000401770	0.979	6.8 kDa mitochondrial proteolipid

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005215	0.996	transporter activity
GO:0003824	0.993	catalytic activity
GO:0022857	0.965	transmembrane transporter activity
GO:0015078	0.943	proton transmembrane transporter activity
GO:0016874	0.902	ligase activity
GO:0022803	0.880	passive transmembrane transporter activity
GO:0015267	0.865	channel activity
GO:0046933	0.864	proton-transporting ATP synthase activity, rotational mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0009141	0.981	nucleoside triphosphate metabolic process
GO:0009150	0.981	purine ribonucleotide metabolic process
GO:0009144	0.967	purine nucleoside triphosphate metabolic process
GO:0046034	0.952	ATP metabolic process
GO:0045333	0.892	cellular respiration
GO:0009060	0.792	aerobic respiration
GO:0006164	0.769	purine nucleotide biosynthetic process
GO:0009145	0.757	purine nucleoside triphosphate biosynthetic process
GO:0046390	0.752	ribose phosphate biosynthetic process
GO:0015986	0.720	proton motive force-driven ATP synthesis
GO:0006119	0.632	oxidative phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0098800	1.000	inner mitochondrial membrane protein complex
GO:0005753	0.965	mitochondrial proton-transporting ATP synthase complex
GO:0033177	0.386	proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263	0.375	proton-transporting ATP synthase complex, coupling factor F(o)
GO:0000276	0.303	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.902	Ligases.
RHEA:57720	0.864	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.864	H(+)-transporting two-sector ATPase.

[back to server]