StarFunc result for job id P56524

User Input

>input (1084 residues)
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IAH0	0.473	0.485	0.000	1052	0.764	0.787	A0A0R4IAH0.pdb.gz	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
2	AFDB:P56524	1.000	1.000	0.000	1084	1.000	1.000	P56524.pdb.gz	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
3	AFDB:Q9UQL6	0.436	0.423	5.453E-96	1122	0.601	0.581	Q9UQL6.pdb.gz	HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens OX=9606 GN=HDAC5 PE=1 SV=2
4	AFDB:J3KPH8	0.356	0.380	8.650E-74	1014	0.444	0.474	J3KPH8.pdb.gz	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
5	PDB:5eduB	0.308	0.459	9.086E-40	723	0.159	0.238	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
6	PDB:6z6fB	0.310	0.500	1.595E-34	661	0.145	0.238	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
7	PDB:7sggA	0.310	0.514	1.981E-34	644	0.118	0.199	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
8	PDB:6uijA	0.310	0.534	4.338E-33	620	0.119	0.208	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
9	PDB:5ikkA	0.279	0.498	1.591E-32	594	0.136	0.247	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
10	PDB:5g0yB	0.289	0.787	7.030E-29	377	0.101	0.292	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
11	PDB:7zzuB	0.282	0.774	1.704E-21	371	0.081	0.237	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
12	PDB:4qa0A	0.276	0.754	2.116E-21	371	0.075	0.218	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
13	PDB:3sfhA	0.260	0.773	1.334E-20	342	0.077	0.243	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
14	PDB:5zeeB	0.161	0.473	2.646E-4	297	0.040	0.145	5zeeB.pdb.gz	Structural insights into Entamoeba histolytica arginase and structure-based identification of novel non-amino acid based inhibitors as potential antiamoebic molecules.
15	AFDB:F4IRA9	0.077	0.117	5.300E-3	636	0.080	0.137	F4IRA9.pdb.gz	F4IRA9_ARATH IQ-domain 29 OS=Arabidopsis thaliana OX=3702 GN=IQD29 PE=1 SV=1
16	AFDB:A0A0U1RRM6	0.085	0.112	2.690E-2	802	0.112	0.151	A0A0U1RRM6.pdb.gz	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
17	AFDB:Q03173	0.089	0.117	3.930E-2	802	0.109	0.147	Q03173.pdb.gz	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
18	AFDB:Q54WH7	0.085	0.118	7.527E-2	759	0.087	0.124	Q54WH7.pdb.gz	Y5961_DICDI Putative uncharacterized protein DDB_G0279653 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279653 PE=4 SV=1
19	AFDB:O81283	0.078	0.062	1.042E-1	1503	0.137	0.099	O81283.pdb.gz	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
20	AFDB:D4A7V6	0.078	0.046	1.100E-1	1962	0.094	0.052	D4A7V6.pdb.gz	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K082	988	1043	0.545	0.567	A0A0G2K082_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=2
2	A0A0R4IAH0	1567	1052	0.768	0.791	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
3	A0A8I5XW09	1009	1089	0.594	0.591	A0A8I5XW09_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
4	A0A8I5ZWP6	783	1024	0.409	0.433	A0A8I5ZWP6_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=1
5	A0A8I6G4R8	1016	1114	0.608	0.592	A0A8I6G4R8_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
6	E5RQ38	1023	1068	0.565	0.573	E5RQ38_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
7	E5RQ39	724	934	0.373	0.433	E5RQ39_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
8	E7FH14	1122	1128	0.610	0.586	E7FH14_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=hdac5 PE=3 SV=2
9	F1LM64	951	970	0.530	0.593	F1LM64_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=1 SV=4
10	J3KPH8	758	1014	0.447	0.478	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
11	P56524	2214	1084	1.000	1.000	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
12	P83038	1864	1080	0.907	0.910	HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus OX=9031 GN=HDAC4 PE=2 SV=1
13	Q08BS8	1535	1023	0.752	0.797	Q08BS8_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=zgc:152701 PE=1 SV=1
14	Q6NZM9	1860	1076	0.927	0.934	HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus OX=10090 GN=Hdac4 PE=1 SV=1
15	Q8C2B3	780	938	0.450	0.520	HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus OX=10090 GN=Hdac7 PE=1 SV=2
16	Q8WUI4	809	952	0.467	0.532	HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=2
17	Q99P99	1862	1077	0.925	0.931	HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus OX=10116 GN=Hdac4 PE=1 SV=2
18	Q9UKV0	988	1011	0.548	0.588	HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens OX=9606 GN=HDAC9 PE=1 SV=2
19	Q9UQL6	999	1122	0.606	0.586	HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens OX=9606 GN=HDAC5 PE=1 SV=2
20	Q9Z2V6	1010	1113	0.607	0.591	HDAC5_MOUSE Histone deacetylase 5 OS=Mus musculus OX=10090 GN=Hdac5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12203 HDAC4_Gln	1.7e-33	125.9	Glutamine rich N terminal domain of histone deacetylase 4
2	PF00850 Hist_deacetyl	1.5e-81	285.8	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264606

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
2	9606.ENSP00000348056	0.999	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
4	9606.ENSP00000231498	0.998	Nuclear pore complex protein Nup155
5	9606.ENSP00000296785	0.998	Ankyrin repeat family A protein 2
6	9606.ENSP00000340874	0.998	Myocyte-specific enhancer factor 2C
7	9606.ENSP00000360493	0.997	Runt-related transcription factor 2
8	9606.ENSP00000212015	0.996	NAD-dependent protein deacetylase sirtuin-1
9	9606.ENSP00000271555	0.996	Myocyte-specific enhancer factor 2D
10	9606.ENSP00000302967	0.993	Histone deacetylase 3
11	9606.ENSP00000361930	0.993	14-3-3 protein beta/alpha
12	9606.ENSP00000305071	0.992	DNA-binding protein RFXANK
13	9606.ENSP00000264335	0.988	14-3-3 protein epsilon
14	9606.ENSP00000332973	0.986	Mothers against decapentaplegic homolog 3
15	9606.ENSP00000346389	0.984	Myocyte-specific enhancer factor 2A
16	9606.ENSP00000405330	0.983	Estrogen receptor
17	9606.ENSP00000265354	0.978	Serum response factor
18	9606.ENSP00000283195	0.970	E3 SUMO-protein ligase RanBP2
19	9606.ENSP00000437955	0.970	Hypoxia-inducible factor 1-alpha
20	9606.ENSP00000384371	0.966	B-cell lymphoma 6 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0004407	1.000	histone deacetylase activity
GO:0019899	0.999	enzyme binding
GO:0043565	0.995	sequence-specific DNA binding
GO:0061629	0.992	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000978	0.988	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042826	0.986	histone deacetylase binding
GO:0042802	0.959	identical protein binding
GO:0016740	0.925	transferase activity
GO:0043167	0.919	ion binding
GO:0003682	0.906	chromatin binding
GO:0046872	0.905	metal ion binding
GO:0008270	0.885	zinc ion binding
GO:0019789	0.875	SUMO transferase activity
GO:0030955	0.864	potassium ion binding
GO:0140110	0.683	transcription regulator activity
GO:0003712	0.312	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0032501	0.983	multicellular organismal process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0009889	0.976	regulation of biosynthetic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0050896	0.967	response to stimulus
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0019219	0.965	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.963	positive regulation of biological process
GO:0010556	0.962	regulation of macromolecule biosynthetic process
GO:0051252	0.962	regulation of RNA metabolic process
GO:0010468	0.956	regulation of gene expression
GO:0006355	0.952	regulation of DNA-templated transcription
GO:0048856	0.925	anatomical structure development
GO:0050793	0.868	regulation of developmental process
GO:0048522	0.856	positive regulation of cellular process
GO:0048519	0.825	negative regulation of biological process
GO:0048523	0.816	negative regulation of cellular process
GO:0031324	0.796	negative regulation of cellular metabolic process
GO:0051239	0.789	regulation of multicellular organismal process
GO:0031327	0.784	negative regulation of cellular biosynthetic process
GO:0009893	0.763	positive regulation of metabolic process
GO:0071704	0.747	organic substance metabolic process
GO:0044238	0.732	primary metabolic process
GO:0042221	0.726	response to chemical
GO:0010604	0.716	positive regulation of macromolecule metabolic process
GO:0045595	0.714	regulation of cell differentiation
GO:0071840	0.712	cellular component organization or biogenesis
GO:0043170	0.704	macromolecule metabolic process
GO:0051172	0.698	negative regulation of nitrogen compound metabolic process
GO:0006357	0.697	regulation of transcription by RNA polymerase II
GO:0045935	0.695	positive regulation of nucleobase-containing compound metabolic process
GO:0030154	0.691	cell differentiation
GO:0006807	0.686	nitrogen compound metabolic process
GO:0010558	0.685	negative regulation of macromolecule biosynthetic process
GO:0016043	0.683	cellular component organization
GO:0051716	0.673	cellular response to stimulus
GO:0045892	0.665	negative regulation of DNA-templated transcription
GO:0007275	0.659	multicellular organism development
GO:0045893	0.658	positive regulation of DNA-templated transcription
GO:0048731	0.583	system development
GO:0006950	0.541	response to stress
GO:0048583	0.532	regulation of response to stimulus
GO:0065009	0.495	regulation of molecular function
GO:0045944	0.495	positive regulation of transcription by RNA polymerase II
GO:0000122	0.477	negative regulation of transcription by RNA polymerase II
GO:0006325	0.472	chromatin organization
GO:0043412	0.466	macromolecule modification
GO:1901564	0.462	organonitrogen compound metabolic process
GO:0019538	0.443	protein metabolic process
GO:0051093	0.440	negative regulation of developmental process
GO:0051147	0.418	regulation of muscle cell differentiation
GO:0042127	0.383	regulation of cell population proliferation
GO:0036211	0.367	protein modification process
GO:0010033	0.346	response to organic substance
GO:0048468	0.346	cell development
GO:0051246	0.312	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.997	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0032991	0.985	protein-containing complex
GO:0005829	0.967	cytosol
GO:0140513	0.746	nuclear protein-containing complex
GO:1902494	0.728	catalytic complex
GO:0000118	0.443	histone deacetylase complex
GO:0043232	0.381	intracellular non-membrane-bounded organelle
GO:0016604	0.371	nuclear body
GO:0017053	0.368	transcription repressor complex
GO:0016607	0.351	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.
EC:2.-.-.-	0.925	Transferases.

[back to server]