StarFunc result for job id P56539

User Input

>input (151 residues)
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51637	0.862	0.862	2.418E-22	151	0.947	0.947	P51637.pdb.gz	CAV3_MOUSE Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1
2	AFDB:Q6YLH7	0.868	0.873	1.935E-18	150	0.728	0.733	Q6YLH7.pdb.gz	Q6YLH7_DANRE Caveolin OS=Danio rerio OX=7955 GN=im:6902906 PE=1 SV=1
3	AFDB:Q6YLH9	0.807	0.685	2.572E-17	181	0.636	0.530	Q6YLH9.pdb.gz	Q6YLH9_DANRE Caveolin OS=Danio rerio OX=7955 GN=CAV1 PE=1 SV=1
4	AFDB:P35431	0.809	0.696	2.754E-17	178	0.669	0.567	P35431.pdb.gz	CAV1_CHICK Caveolin-1 OS=Gallus gallus OX=9031 GN=CAV1 PE=2 SV=1
5	AFDB:P33724	0.759	0.656	4.807E-16	178	0.636	0.539	P33724.pdb.gz	CAV1_CANLF Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1
6	AFDB:W5UMJ4	0.606	0.524	5.145E-16	180	0.623	0.522	W5UMJ4.pdb.gz	W5UMJ4_ICTPU Caveolin OS=Ictalurus punctatus OX=7998 GN=cav1 PE=2 SV=1
7	PDB:7sc0A	0.662	0.753	4.468E-13	129	0.576	0.674	7sc0A.pdb.gz
8	AFDB:Q2IBC5	0.434	0.407	4.042E-8	162	0.331	0.309	Q2IBC5.pdb.gz	CAV2_RAT Caveolin-2 OS=Rattus norvegicus OX=10116 GN=Cav2 PE=1 SV=2
9	AFDB:P51636	0.457	0.428	1.286E-7	162	0.351	0.327	P51636.pdb.gz	CAV2_HUMAN Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2 PE=1 SV=2
10	AFDB:Q66WT7	0.457	0.429	2.720E-7	162	0.351	0.327	Q66WT7.pdb.gz	CAV2_BOVIN Caveolin-2 OS=Bos taurus OX=9913 GN=CAV2 PE=1 SV=1
11	AFDB:Q94051	0.649	0.445	2.948E-6	235	0.232	0.149	Q94051.pdb.gz	CAV1_CAEEL Caveolin-1 OS=Caenorhabditis elegans OX=6239 GN=cav-1 PE=2 SV=1
12	PDB:3jb9i	0.220	0.209	2.166	161	0.132	0.124	3jb9i.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
13	PDB:7ypbC	0.202	0.031	4.903	1292	0.079	0.009	7ypbC.pdb.gz	Structural basis for intrinsic transcription termination.
14	PDB:2zbkB	0.141	0.052	7.377	506	0.106	0.032	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56539	4.41e-110	311	151	1.000	1.000	CAV3_HUMAN Caveolin-3 OS=Homo sapiens OX=9606 GN=CAV3 PE=1 SV=1
2	Q2KI43	8.19e-108	305	151	0.980	0.980	CAV3_BOVIN Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1
3	P51638	9.38e-106	300	151	0.947	0.947	CAV3_RAT Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1
4	P51637	1.66e-105	299	151	0.947	0.947	CAV3_MOUSE Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1
5	Q6YLH7	1.74e-83	243	150	0.735	0.740	Q6YLH7_DANRE Caveolin OS=Danio rerio OX=7955 GN=im:6902906 PE=1 SV=1
6	P35431	6.92e-76	225	178	0.669	0.567	CAV1_CHICK Caveolin-1 OS=Gallus gallus OX=9031 GN=CAV1 PE=2 SV=1
7	Q6YLH8	4.61e-74	219	148	0.636	0.649	Q6YLH8_DANRE Caveolin OS=Danio rerio OX=7955 GN=wu:fc07c04 PE=1 SV=1
8	Q6YLH9	5.53e-74	221	181	0.636	0.530	Q6YLH9_DANRE Caveolin OS=Danio rerio OX=7955 GN=CAV1 PE=1 SV=1
9	Q6RVA9	3.72e-73	218	178	0.642	0.545	CAV1_PIG Caveolin-1 OS=Sus scrofa OX=9823 GN=CAV1 PE=2 SV=1
10	P49817	9.96e-73	217	178	0.642	0.545	CAV1_MOUSE Caveolin-1 OS=Mus musculus OX=10090 GN=Cav1 PE=1 SV=1
11	P79132	1.03e-72	217	178	0.642	0.545	CAV1_BOVIN Caveolin-1 OS=Bos taurus OX=9913 GN=CAV1 PE=2 SV=1
12	P33724	2.94e-72	216	178	0.636	0.539	CAV1_CANLF Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1
13	P41350	1.13e-71	214	178	0.629	0.534	CAV1_RAT Caveolin-1 OS=Rattus norvegicus OX=10116 GN=Cav1 PE=1 SV=3
14	Q03135	1.64e-71	214	178	0.636	0.539	CAV1_HUMAN Caveolin-1 OS=Homo sapiens OX=9606 GN=CAV1 PE=1 SV=4
15	W5UMJ4	4.65e-71	213	180	0.623	0.522	W5UMJ4_ICTPU Caveolin OS=Ictalurus punctatus OX=7998 GN=cav1 PE=2 SV=1
16	Q66WT7	1.07e-25	97.4	162	0.331	0.309	CAV2_BOVIN Caveolin-2 OS=Bos taurus OX=9913 GN=CAV2 PE=1 SV=1
17	P51636	1.18e-25	97.4	162	0.325	0.302	CAV2_HUMAN Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2 PE=1 SV=2
18	Q2IBC5	5.18e-25	95.9	162	0.311	0.290	CAV2_RAT Caveolin-2 OS=Rattus norvegicus OX=10116 GN=Cav2 PE=1 SV=2
19	Q9WVC3	1.87e-24	94.4	162	0.311	0.290	CAV2_MOUSE Caveolin-2 OS=Mus musculus OX=10090 GN=Cav2 PE=1 SV=1
20	Q94051	2.86e-15	72.0	235	0.238	0.153	CAV1_CAEEL Caveolin-1 OS=Caenorhabditis elegans OX=6239 GN=cav-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01146 Caveolin	7.4e-54	192.7	Caveolin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004553

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012408	0.973	Uncharacterized protein
2	61853.ENSNLEP00000023336	0.966	Dystroglycan 1 (dystrophin-associated glycoprotein 1)
3	61853.ENSNLEP00000004866	0.956	Nitric oxide synthase
4	61853.ENSNLEP00000007631	0.949	Tyrosine-protein kinase
5	61853.ENSNLEP00000012359	0.943	Uncharacterized protein
6	61853.ENSNLEP00000018926	0.936	Sarcoglycan, epsilon
7	61853.ENSNLEP00000009927	0.925	Sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
8	61853.ENSNLEP00000004695	0.918	Sarcoglycan, delta (35kDa dystrophin-associated glycoprotein)
9	61853.ENSNLEP00000012154	0.895	Syntrophin, alpha 1
10	61853.ENSNLEP00000019746	0.895	Tripartite motif containing 72, E3 ubiquitin protein ligase
11	61853.ENSNLEP00000012592	0.888	Dysferlin
12	61853.ENSNLEP00000010942	0.852	Sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
13	61853.ENSNLEP00000020618	0.837	Calmodulin 2 (phosphorylase kinase, delta)
14	61853.ENSNLEP00000014010	0.833	Caveolin
15	61853.ENSNLEP00000019365	0.823	Heat shock protein 90kDa alpha (cytosolic), class A member 1
16	61853.ENSNLEP00000008756	0.822	Myosin, light chain 1, alkali
17	61853.ENSNLEP00000010419	0.822	Receptor protein-tyrosine kinase
18	61853.ENSNLEP00000014017	0.814	May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (By similarity). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (By [...]
19	61853.ENSNLEP00000016161	0.812	Sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
20	61853.ENSNLEP00000009364	0.811	Prion protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0044325	0.922	transmembrane transporter binding
GO:0019899	0.693	enzyme binding
GO:0098772	0.364	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0065008	0.990	regulation of biological quality
GO:0044092	0.990	negative regulation of molecular function
GO:0010959	0.990	regulation of metal ion transport
GO:0014743	0.988	regulation of muscle hypertrophy
GO:0048519	0.987	negative regulation of biological process
GO:0071840	0.981	cellular component organization or biogenesis
GO:1904062	0.980	regulation of monoatomic cation transmembrane transport
GO:1903522	0.979	regulation of blood circulation
GO:0032409	0.978	regulation of transporter activity
GO:0006937	0.976	regulation of muscle contraction
GO:0051128	0.975	regulation of cellular component organization
GO:0008016	0.972	regulation of heart contraction
GO:0006942	0.970	regulation of striated muscle contraction
GO:0042391	0.968	regulation of membrane potential
GO:0032970	0.968	regulation of actin filament-based process
GO:0032412	0.968	regulation of monoatomic ion transmembrane transporter activity
GO:0032501	0.964	multicellular organismal process
GO:0055117	0.963	regulation of cardiac muscle contraction
GO:0043502	0.959	regulation of muscle adaptation
GO:1903115	0.958	regulation of actin filament-based movement
GO:0043271	0.957	negative regulation of monoatomic ion transport
GO:0050896	0.956	response to stimulus
GO:0010611	0.953	regulation of cardiac muscle hypertrophy
GO:0048523	0.952	negative regulation of cellular process
GO:0051924	0.952	regulation of calcium ion transport
GO:0086004	0.949	regulation of cardiac muscle cell contraction
GO:0019220	0.947	regulation of phosphate metabolic process
GO:0007009	0.943	plasma membrane organization
GO:0048518	0.941	positive regulation of biological process
GO:0044091	0.941	membrane biogenesis
GO:1903169	0.933	regulation of calcium ion transmembrane transport
GO:0031400	0.932	negative regulation of protein modification process
GO:0051179	0.929	localization
GO:0042325	0.929	regulation of phosphorylation
GO:0034763	0.928	negative regulation of transmembrane transport
GO:0006810	0.920	transport
GO:1904063	0.920	negative regulation of cation transmembrane transport
GO:0006469	0.919	negative regulation of protein kinase activity
GO:0048856	0.914	anatomical structure development
GO:0048522	0.912	positive regulation of cellular process
GO:0003012	0.911	muscle system process
GO:0033043	0.911	regulation of organelle organization
GO:0071709	0.911	membrane assembly
GO:0010646	0.903	regulation of cell communication
GO:0050793	0.898	regulation of developmental process
GO:0044087	0.897	regulation of cellular component biogenesis
GO:0051716	0.892	cellular response to stimulus
GO:0008015	0.877	blood circulation
GO:1902531	0.877	regulation of intracellular signal transduction
GO:0051493	0.876	regulation of cytoskeleton organization
GO:0061061	0.863	muscle structure development
GO:1902903	0.863	regulation of supramolecular fiber organization
GO:0003254	0.853	regulation of membrane depolarization
GO:0051050	0.849	positive regulation of transport
GO:0023057	0.846	negative regulation of signaling
GO:0010648	0.846	negative regulation of cell communication
GO:0009968	0.843	negative regulation of signal transduction
GO:0045595	0.836	regulation of cell differentiation
GO:0051147	0.827	regulation of muscle cell differentiation
GO:0051093	0.821	negative regulation of developmental process
GO:0051153	0.817	regulation of striated muscle cell differentiation
GO:0030029	0.804	actin filament-based process
GO:0070887	0.780	cellular response to chemical stimulus
GO:0042127	0.755	regulation of cell population proliferation
GO:0048513	0.735	animal organ development
GO:0007275	0.735	multicellular organism development
GO:0006950	0.715	response to stress
GO:0007154	0.712	cell communication
GO:0006996	0.707	organelle organization
GO:0023052	0.702	signaling
GO:0009893	0.694	positive regulation of metabolic process
GO:0010033	0.688	response to organic substance
GO:0007010	0.682	cytoskeleton organization
GO:0048869	0.668	cellular developmental process
GO:0009719	0.664	response to endogenous stimulus
GO:0030154	0.663	cell differentiation
GO:0080134	0.645	regulation of response to stress
GO:0048731	0.608	system development
GO:0009653	0.593	anatomical structure morphogenesis
GO:0051641	0.592	cellular localization
GO:0009725	0.568	response to hormone
GO:0006936	0.564	muscle contraction
GO:0009888	0.563	tissue development
GO:0097435	0.549	supramolecular fiber organization
GO:0051241	0.538	negative regulation of multicellular organismal process
GO:0016192	0.532	vesicle-mediated transport
GO:0014706	0.530	striated muscle tissue development
GO:0043408	0.522	regulation of MAPK cascade
GO:0006897	0.506	endocytosis
GO:0042692	0.465	muscle cell differentiation
GO:0007507	0.463	heart development
GO:0048468	0.447	cell development
GO:0009628	0.445	response to abiotic stimulus
GO:0033036	0.434	macromolecule localization
GO:0048646	0.427	anatomical structure formation involved in morphogenesis
GO:0008104	0.414	protein localization
GO:0044237	0.370	cellular metabolic process
GO:0044238	0.358	primary metabolic process
GO:0071704	0.344	organic substance metabolic process
GO:0007165	0.331	signal transduction
GO:0003015	0.329	heart process
GO:0006941	0.324	striated muscle contraction
GO:0010604	0.313	positive regulation of macromolecule metabolic process
GO:0044854	0.307	plasma membrane raft assembly
GO:0070836	0.300	caveola assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0042383	0.980	sarcolemma
GO:0098590	0.936	plasma membrane region
GO:0032991	0.924	protein-containing complex
GO:0098857	0.886	membrane microdomain
GO:0045121	0.872	membrane raft
GO:0005622	0.850	intracellular anatomical structure
GO:0005737	0.839	cytoplasm
GO:0043226	0.837	organelle
GO:0044853	0.784	plasma membrane raft
GO:0043231	0.777	intracellular membrane-bounded organelle
GO:0005901	0.697	caveola
GO:0012505	0.672	endomembrane system
GO:0070013	0.368	intracellular organelle lumen
GO:0098797	0.343	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]