StarFunc result for job id P56545

User Input

>input (445 residues)
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56545	1.000	1.000	3.054E-85	445	1.000	1.000	P56545.pdb.gz	CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1
2	AFDB:A9UL56	0.773	0.488	2.656E-72	710	0.845	0.530	A9UL56.pdb.gz
3	AFDB:O88712	0.804	0.811	1.996E-70	441	0.771	0.778	O88712.pdb.gz	CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus OX=10090 GN=Ctbp1 PE=1 SV=2
4	AFDB:Q7ZU55	0.795	0.788	3.010E-69	449	0.773	0.766	Q7ZU55.pdb.gz	Q7ZU55_DANRE C-terminal binding protein 1 OS=Danio rerio OX=7955 GN=wu:fi43a11 PE=1 SV=1
5	AFDB:A0A2R8QBA1	0.796	0.297	7.302E-69	1200	0.789	0.292	A0A2R8QBA1.pdb.gz
6	AFDB:Q5BU17	0.756	0.393	2.025E-67	860	0.773	0.400	Q5BU17.pdb.gz	Q5BU17_DANRE C-terminal-binding protein 2 OS=Danio rerio OX=7955 GN=ctbp2l PE=2 SV=1
7	AFDB:O46036	0.759	0.710	4.053E-61	476	0.611	0.571	O46036.pdb.gz	CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster OX=7227 GN=CtBP PE=1 SV=3
8	AFDB:Q20595	0.733	0.454	1.343E-49	727	0.465	0.285	Q20595.pdb.gz	CTBP1_CAEEL C-terminal-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ctbp-1 PE=1 SV=3
9	AFDB:O08651	0.645	0.544	8.827E-30	533	0.225	0.188	O08651.pdb.gz	SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Phgdh PE=1 SV=3
10	AFDB:P9WNX3	0.621	0.530	2.263E-29	528	0.227	0.191	P9WNX3.pdb.gz	SERA_MYCTU D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serA PE=1 SV=1
11	PDB:1ygyA	0.595	0.511	8.724E-28	527	0.225	0.190	1ygyA.pdb.gz
12	PDB:5z1zC	0.581	0.790	2.703E-26	316	0.198	0.278	5z1zC.pdb.gz
13	PDB:3jtmA	0.617	0.766	1.505E-25	351	0.178	0.225	3jtmA.pdb.gz	Structure of recombinant formate dehydrogenase from Arabidopsis thaliana
14	PDB:2p9eA	0.541	0.586	2.217E-25	406	0.184	0.202	2p9eA.pdb.gz	The Effect of Hinge Mutations on Effector Binding and Domain Rotation in Escherichia coli D-3-Phosphoglycerate Dehydrogenase
15	PDB:7wn9B	0.616	0.784	1.922E-24	341	0.169	0.220	7wn9B.pdb.gz
16	PDB:2gcgA	0.637	0.861	2.832E-24	324	0.171	0.235	2gcgA.pdb.gz	Structural basis of substrate specificity in human glyoxylate reductase/hydroxypyruvate reductase
17	PDB:3ba1A	0.628	0.878	1.576E-23	312	0.169	0.240	3ba1A.pdb.gz
18	PDB:1sc6D	0.458	0.517	5.955E-23	384	0.187	0.216	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase
19	PDB:2fssA	0.591	0.734	5.955E-23	353	0.169	0.212	2fssA.pdb.gz
20	PDB:5mh5A	0.561	0.786	2.513E-22	308	0.173	0.250	5mh5A.pdb.gz	Productive ternary complexes of D-2-hydroxyacid dehydrogenase provide insights into the chiral specificity of its reaction mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y8U5	0.0	721	430	0.775	0.802	H0Y8U5_HUMAN C-terminal binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=2
2	O46036	0.0	552	476	0.582	0.544	CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster OX=7227 GN=CtBP PE=1 SV=3
3	O88712	0.0	720	441	0.773	0.780	CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus OX=10090 GN=Ctbp1 PE=1 SV=2
4	P56545	0.0	923	445	1.000	1.000	CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1
5	P56546	0.0	920	445	0.996	0.996	CTBP2_MOUSE C-terminal-binding protein 2 OS=Mus musculus OX=10090 GN=Ctbp2 PE=1 SV=2
6	Q0VCQ1	0.0	919	445	0.993	0.993	CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus OX=9913 GN=CTBP2 PE=1 SV=1
7	Q13363	0.0	726	440	0.775	0.784	CTBP1_HUMAN C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=2
8	Q5BU17	0.0	729	860	0.771	0.399	Q5BU17_DANRE C-terminal-binding protein 2 OS=Danio rerio OX=7955 GN=ctbp2l PE=2 SV=1
9	Q5BU19	0.0	741	1147	0.787	0.305	Q5BU19_DANRE C-terminal-binding protein 2 isoform 1 OS=Danio rerio OX=7955 GN=wu:fb96g03 PE=1 SV=1
10	Q5ZIZ6	0.0	741	430	0.780	0.807	Q5ZIZ6_CHICK C-terminal binding protein 1 OS=Gallus gallus OX=9031 GN=CTBP1 PE=1 SV=1
11	Q7ZU55	0.0	714	449	0.760	0.753	Q7ZU55_DANRE C-terminal binding protein 1 OS=Danio rerio OX=7955 GN=wu:fi43a11 PE=1 SV=1
12	Q9DEG6	0.0	835	444	0.888	0.890	Q9DEG6_DANRE C-terminal-binding protein 2 isoform 2 OS=Danio rerio OX=7955 GN=CtBP2 PE=1 SV=1
13	Q9Z2F5	0.0	720	430	0.773	0.800	CTBP1_RAT C-terminal-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=3
14	X5D8Y5	0.0	726	440	0.775	0.784	X5D8Y5_HUMAN C-terminal binding protein 1 isoform C (Fragment) OS=Homo sapiens OX=9606 GN=CTBP1 PE=2 SV=1
15	H0Y8W7	2.79e-141	407	287	0.445	0.690	H0Y8W7_HUMAN C-terminal binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=1
16	Q20595	6.57e-133	401	727	0.425	0.260	CTBP1_CAEEL C-terminal-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ctbp-1 PE=1 SV=3
17	P9WNX3	8.19e-38	146	528	0.222	0.188	SERA_MYCTU D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serA PE=1 SV=1
18	Q61753	1.42e-35	140	533	0.213	0.178	SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus OX=10090 GN=Phgdh PE=1 SV=3
19	O43175	1.71e-35	139	533	0.213	0.178	SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4
20	O08651	2.51e-35	139	533	0.211	0.176	SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Phgdh PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00389 2-Hacid_dh	1.1e-26	104.5	D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
2	PF02826 2-Hacid_dh_C	6e-52	187.1	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
3	PF03446 NAD_binding_2	2.9	19.5	NAD binding domain of 6-phosphogluconate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000012719

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000005275	0.988	C-terminal binding protein 1
2	43179.ENSSTOP00000010833	0.977	Histone deacetylase 1
3	43179.ENSSTOP00000014686	0.949	Zinc finger E-box binding homeobox 1
4	43179.ENSSTOP00000011457	0.947	Histone deacetylase 2
5	43179.ENSSTOP00000004084	0.940	Recombination signal binding protein for immunoglobulin kappa J region
6	43179.ENSSTOP00000017745	0.934	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
7	43179.ENSSTOP00000018741	0.930	Transcription factor 7-like 1 (T-cell specific, HMG-box)
8	43179.ENSSTOP00000006127	0.918	Transcription factor 7-like 2 (T-cell specific, HMG-box)
9	43179.ENSSTOP00000002197	0.892	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
10	43179.ENSSTOP00000008339	0.891	Recombination signal binding protein for immunoglobulin kappa J region-like
11	43179.ENSSTOP00000011981	0.889	Bromodomain PHD finger transcription factor
12	43179.ENSSTOP00000011991	0.880	MDS1 and EVI1 complex locus
13	43179.ENSSTOP00000015003	0.880	MDS1 and EVI1 complex locus
14	43179.ENSSTOP00000001228	0.870	Lymphoid enhancer-binding factor 1
15	43179.ENSSTOP00000015255	0.868	Transcription factor 7 (T-cell specific, HMG-box)
16	43179.ENSSTOP00000009693	0.841	Ligand dependent nuclear receptor corepressor
17	43179.ENSSTOP00000000650	0.840	E1A binding protein p300
18	43179.ENSSTOP00000014441	0.834	Catenin beta 1
19	43179.ENSSTOP00000018885	0.827	Phosphoserine aminotransferase 1
20	43179.ENSSTOP00000010500	0.820	RB binding protein 8, endonuclease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0001221	0.996	transcription coregulator binding
GO:0003824	0.987	catalytic activity
GO:0042802	0.981	identical protein binding
GO:0140297	0.973	DNA-binding transcription factor binding
GO:0016491	0.859	oxidoreductase activity
GO:0019899	0.819	enzyme binding
GO:0097159	0.810	organic cyclic compound binding
GO:1901363	0.796	heterocyclic compound binding
GO:0001222	0.638	transcription corepressor binding
GO:0003682	0.634	chromatin binding
GO:0044877	0.606	protein-containing complex binding
GO:0019900	0.586	kinase binding
GO:0043167	0.518	ion binding
GO:0019901	0.484	protein kinase binding
GO:0036094	0.398	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032501	0.974	multicellular organismal process
GO:0032502	0.948	developmental process
GO:0048856	0.915	anatomical structure development
GO:0007275	0.911	multicellular organism development
GO:0019222	0.888	regulation of metabolic process
GO:0060255	0.883	regulation of macromolecule metabolic process
GO:0051171	0.883	regulation of nitrogen compound metabolic process
GO:0080090	0.880	regulation of primary metabolic process
GO:0010468	0.864	regulation of gene expression
GO:0031323	0.856	regulation of cellular metabolic process
GO:0006355	0.837	regulation of DNA-templated transcription
GO:0048519	0.835	negative regulation of biological process
GO:0048731	0.833	system development
GO:0048523	0.829	negative regulation of cellular process
GO:0048518	0.828	positive regulation of biological process
GO:0009892	0.818	negative regulation of metabolic process
GO:0031324	0.807	negative regulation of cellular metabolic process
GO:0010605	0.800	negative regulation of macromolecule metabolic process
GO:0051172	0.792	negative regulation of nitrogen compound metabolic process
GO:0006357	0.774	regulation of transcription by RNA polymerase II
GO:0071840	0.765	cellular component organization or biogenesis
GO:1903507	0.761	negative regulation of nucleic acid-templated transcription
GO:0016043	0.747	cellular component organization
GO:0048513	0.712	animal organ development
GO:0030154	0.695	cell differentiation
GO:0048522	0.660	positive regulation of cellular process
GO:0007399	0.646	nervous system development
GO:0050896	0.619	response to stimulus
GO:0009893	0.616	positive regulation of metabolic process
GO:0010604	0.608	positive regulation of macromolecule metabolic process
GO:0045892	0.608	negative regulation of DNA-templated transcription
GO:0051173	0.606	positive regulation of nitrogen compound metabolic process
GO:2000026	0.598	regulation of multicellular organismal development
GO:0045595	0.596	regulation of cell differentiation
GO:0031325	0.557	positive regulation of cellular metabolic process
GO:0048699	0.546	generation of neurons
GO:0000122	0.486	negative regulation of transcription by RNA polymerase II
GO:0050767	0.485	regulation of neurogenesis
GO:0051716	0.457	cellular response to stimulus
GO:0048666	0.454	neuron development
GO:0045935	0.421	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.416	positive regulation of cellular biosynthetic process
GO:0061024	0.408	membrane organization
GO:0045893	0.403	positive regulation of DNA-templated transcription
GO:0007423	0.402	sensory organ development
GO:0022607	0.400	cellular component assembly
GO:0048583	0.398	regulation of response to stimulus
GO:0021675	0.393	nerve development
GO:0045944	0.388	positive regulation of transcription by RNA polymerase II
GO:0009966	0.386	regulation of signal transduction
GO:0042551	0.369	neuron maturation
GO:0014013	0.359	regulation of gliogenesis
GO:0007416	0.355	synapse assembly
GO:0060384	0.353	innervation
GO:0045161	0.341	neuronal ion channel clustering
GO:0071704	0.338	organic substance metabolic process
GO:0043010	0.336	camera-type eye development
GO:0065009	0.324	regulation of molecular function
GO:0044237	0.302	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005737	0.903	cytoplasm
GO:0071944	0.525	cell periphery
GO:0016020	0.341	membrane
GO:0032991	0.303	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.859	Oxidoreductases.

[back to server]