StarFunc result for job id P56556

User Input

>input (128 residues)
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR
DKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLS
KFYVGHDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56556	1.000	1.000	6.889E-20	128	1.000	1.000	P56556.pdb.gz	NDUA6_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFA6 PE=1 SV=4
2	AFDB:Q9CQZ5	0.914	0.895	2.096E-17	131	0.875	0.855	Q9CQZ5.pdb.gz	NDUA6_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Mus musculus OX=10090 GN=Ndufa6 PE=1 SV=1
3	PDB:7qsmW	0.892	0.983	2.669E-16	116	0.852	0.940	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
4	AFDB:Q7JZK1	0.853	0.879	4.528E-11	124	0.430	0.444	Q7JZK1.pdb.gz	Q7JZK1_DROME NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Drosophila melanogaster OX=7227 GN=ND-B14 PE=1 SV=1
5	AFDB:O18236	0.902	0.883	7.056E-8	131	0.344	0.336	O18236.pdb.gz	O18236_CAEEL Complex I-B14 OS=Caenorhabditis elegans OX=6239 GN=nuo-3 PE=1 SV=1
6	AFDB:Q9LHI0	0.720	0.695	2.627E-6	133	0.289	0.278	Q9LHI0.pdb.gz	NDUA6_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=At3g12260 PE=1 SV=1
7	PDB:7aqrW	0.682	0.771	1.661E-5	112	0.281	0.321	7aqrW.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
8	AFDB:Q388C0	0.643	0.124	5.011E-4	713	0.227	0.041	Q388C0.pdb.gz	Q388C0_TRYB2 Complex 1 LYR protein domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1790 PE=3 SV=1
9	AFDB:Q0VCG0	0.450	0.610	1.661E-2	91	0.180	0.253	Q0VCG0.pdb.gz	LYRM4_BOVIN LYR motif-containing protein 4 OS=Bos taurus OX=9913 GN=LYRM4 PE=3 SV=1
10	AFDB:Q9HD34	0.452	0.612	1.661E-2	91	0.164	0.231	Q9HD34.pdb.gz	LYRM4_HUMAN LYR motif-containing protein 4 OS=Homo sapiens OX=9606 GN=LYRM4 PE=1 SV=1
11	PDB:6uxeB	0.432	0.623	2.173E-2	85	0.164	0.247	6uxeB.pdb.gz	The essential function of ISCU2 and its conserved N-terminus in Fe/S cluster biogenesis
12	AFDB:Q6IPR1	0.494	0.685	2.223E-2	90	0.125	0.178	Q6IPR1.pdb.gz	ETFR1_HUMAN Electron transfer flavoprotein regulatory factor 1 OS=Homo sapiens OX=9606 GN=ETFRF1 PE=1 SV=2
13	AFDB:Q9NU23	0.471	0.664	2.648E-2	88	0.156	0.227	Q9NU23.pdb.gz	LYRM2_HUMAN LYR motif-containing protein 2 OS=Homo sapiens OX=9606 GN=LYRM2 PE=1 SV=1
14	PDB:1gvnA	0.381	0.520	7.633E-1	87	0.062	0.092	1gvnA.pdb.gz
15	PDB:7b93n	0.409	0.302	1.368	178	0.109	0.079	7b93n.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
16	PDB:7b93V	0.330	0.360	2.058	115	0.125	0.139	7b93V.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
17	PDB:7a5hv	0.365	0.618	2.921	69	0.164	0.304	7a5hv.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
18	PDB:7qskV	0.335	0.367	3.479	115	0.117	0.130	7qskV.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
19	PDB:6jcxF	0.319	0.243	3.688	186	0.109	0.075	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
20	PDB:7aqrV	0.292	0.270	3.688	140	0.188	0.171	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56556	3.62e-93	266	128	1.000	1.000	NDUA6_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFA6 PE=1 SV=4
2	Q02366	1.68e-84	244	128	0.906	0.906	NDUA6_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Bos taurus OX=9913 GN=NDUFA6 PE=1 SV=2
3	Q9CQZ5	3.47e-78	228	131	0.875	0.855	NDUA6_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Mus musculus OX=10090 GN=Ndufa6 PE=1 SV=1
4	Q7JZK1	1.83e-40	133	124	0.477	0.492	Q7JZK1_DROME NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Drosophila melanogaster OX=7227 GN=ND-B14 PE=1 SV=1
5	Q9LHI0	7.89e-13	62.8	133	0.297	0.286	NDUA6_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=At3g12260 PE=1 SV=1
6	O18236	7.10e-11	57.8	131	0.344	0.336	O18236_CAEEL Complex I-B14 OS=Caenorhabditis elegans OX=6239 GN=nuo-3 PE=1 SV=1
7	Q388C0	4.44e-06	46.6	713	0.195	0.035	Q388C0_TRYB2 Complex 1 LYR protein domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1790 PE=3 SV=1
8	Q99373	1.3	30.4	253	0.203	0.103	PET20_YEAST Protein PET20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PET20 PE=4 SV=1
9	Q8K215	2.1	28.9	91	0.156	0.220	LYRM4_MOUSE LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1
10	Q91V16	2.1	28.9	86	0.117	0.174	ETFR1_MOUSE Electron transfer flavoprotein regulatory factor 1 OS=Mus musculus OX=10090 GN=Etfrf1 PE=1 SV=1
11	Q03823	3.5	29.6	816	0.125	0.020	YM35_YEAST Uncharacterized protein YMR160W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR160W PE=1 SV=1
12	O42878	4.4	29.3	508	0.164	0.041	INVX_SCHPO Putative invertase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC8E11.01c PE=3 SV=3
13	P32939	4.9	28.9	208	0.141	0.087	YPT7_YEAST Ypt/Rab-type GTPase YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05347 Complex1_LYR	6.6e-06	37.4	Complex 1 protein (LYR family)
2	PF13233 Complex1_LYR_2	2.2	20.4	Complex1_LYR-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000058761

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000000990	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
2	9598.ENSPTRP00000002642	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
3	9598.ENSPTRP00000005010	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
4	9598.ENSPTRP00000006209	0.999	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)
5	9598.ENSPTRP00000006828	0.999	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)
6	9598.ENSPTRP00000007076	0.999	NADH dehydrogenase [ubiquinone] 1 subunit C2
7	9598.ENSPTRP00000007791	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
8	9598.ENSPTRP00000009015	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
9	9598.ENSPTRP00000013017	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9598.ENSPTRP00000013471	0.999	Acyl carrier protein, mitochondrial
11	9598.ENSPTRP00000017727	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
12	9598.ENSPTRP00000018081	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
13	9598.ENSPTRP00000018326	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
14	9598.ENSPTRP00000021865	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
15	9598.ENSPTRP00000021965	0.999	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized (By similarity).
16	9598.ENSPTRP00000022417	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
17	9598.ENSPTRP00000026324	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
18	9598.ENSPTRP00000026930	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
19	9598.ENSPTRP00000028668	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
20	9598.ENSPTRP00000028892	0.999	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity
GO:0005488	0.905	binding
GO:0005515	0.691	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006979	0.990	response to oxidative stress
GO:0009987	0.904	cellular process
GO:0043933	0.665	protein-containing complex organization
GO:0010257	0.660	NADH dehydrogenase complex assembly
GO:0007005	0.627	mitochondrion organization
GO:0033108	0.561	mitochondrial respiratory chain complex assembly
GO:0032981	0.501	mitochondrial respiratory chain complex I assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098800	0.999	inner mitochondrial membrane protein complex
GO:0045271	0.998	respiratory chain complex I
GO:0005746	0.998	mitochondrial respirasome
GO:0005747	0.986	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]