StarFunc result for job id P56589

User Input

>input (373 residues)
MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES
NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSTVAVY
STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI
TVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMP
DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR
PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN
VYEAFSTPQQLEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56589	1.000	1.000	4.895E-48	373	1.000	1.000	P56589.pdb.gz	PEX3_HUMAN Peroxisomal biogenesis factor 3 OS=Homo sapiens OX=9606 GN=PEX3 PE=1 SV=1
2	AFDB:Q9VUL8	0.800	0.777	2.415E-17	385	0.349	0.338	Q9VUL8.pdb.gz	Q9VUL8_DROME Peroxisomal assembly protein PEX3 OS=Drosophila melanogaster OX=7227 GN=Pex3 PE=1 SV=1
3	AFDB:F4J7K3	0.741	0.735	2.456E-14	376	0.255	0.253	F4J7K3.pdb.gz	F4J7K3_ARATH Peroxin 3-1 OS=Arabidopsis thaliana OX=3702 GN=PEX3-1 PE=1 SV=1
4	AFDB:C4R6F0	0.752	0.627	1.579E-13	455	0.241	0.198	C4R6F0.pdb.gz	C4R6F0_KOMPG Peroxisomal biogenesis factor 3 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAS_chr3_1073 PE=3 SV=1
5	AFDB:F4HYJ3	0.709	0.665	8.916E-13	400	0.247	0.230	F4HYJ3.pdb.gz	F4HYJ3_ARATH Peroxin 3 OS=Arabidopsis thaliana OX=3702 GN=PEX3 PE=1 SV=1
6	AFDB:P28795	0.740	0.635	6.251E-12	441	0.198	0.168	P28795.pdb.gz	PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX3 PE=1 SV=1
7	AFDB:O14017	0.643	0.688	4.860E-8	346	0.185	0.199	O14017.pdb.gz	YDPE_SCHPO Uncharacterized protein C29A4.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29A4.14c PE=4 SV=3
8	AFDB:Q383Q3	0.518	0.421	2.816E-5	474	0.123	0.097	Q383Q3.pdb.gz	Q383Q3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2020 PE=4 SV=1
9	AFDB:Q57YH2	0.170	0.177	1.144E-1	355	0.139	0.146	Q57YH2.pdb.gz	Q57YH2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.140 PE=4 SV=1
10	AFDB:Q8H0T6	0.128	0.126	1.549E-1	383	0.121	0.117	Q8H0T6.pdb.gz	PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT2 PE=2 SV=1
11	PDB:1rqiA	0.161	0.187	1.865E-1	300	0.072	0.090	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
12	PDB:7ungA3	0.152	0.165	1.865E-1	333	0.126	0.141	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:7x9yR	0.116	0.128	2.875E-1	293	0.083	0.106	7x9yR.pdb.gz
14	PDB:7ungD2	0.175	0.165	3.418E-1	398	0.118	0.111	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:3lvsB	0.161	0.195	3.727E-1	274	0.094	0.128	3lvsB.pdb.gz
16	PDB:7rroA3	0.151	0.164	3.892E-1	334	0.118	0.132	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:7vgfA	0.132	0.096	4.244E-1	550	0.088	0.060	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
18	PDB:7rroF1	0.140	0.129	4.628E-1	421	0.129	0.114	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:7ungA1	0.115	0.110	4.628E-1	391	0.139	0.133	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:7ph3A	0.175	0.131	5.269E-1	577	0.102	0.066	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56589	0.0	773	373	1.000	1.000	PEX3_HUMAN Peroxisomal biogenesis factor 3 OS=Homo sapiens OX=9606 GN=PEX3 PE=1 SV=1
2	Q9JJK4	0.0	728	372	0.941	0.944	PEX3_RAT Peroxisomal biogenesis factor 3 OS=Rattus norvegicus OX=10116 GN=Pex3 PE=1 SV=1
3	Q9VUL8	6.49e-59	197	385	0.365	0.353	Q9VUL8_DROME Peroxisomal assembly protein PEX3 OS=Drosophila melanogaster OX=7227 GN=Pex3 PE=1 SV=1
4	F4J7K3	3.33e-24	104	376	0.271	0.269	F4J7K3_ARATH Peroxin 3-1 OS=Arabidopsis thaliana OX=3702 GN=PEX3-1 PE=1 SV=1
5	F4HYJ3	3.87e-21	95.9	400	0.263	0.245	F4HYJ3_ARATH Peroxin 3 OS=Arabidopsis thaliana OX=3702 GN=PEX3 PE=1 SV=1
6	Q92262	4.03e-15	78.6	455	0.265	0.218	PEX3_PICPA Peroxisomal biogenesis factor 3 OS=Komagataella pastoris OX=4922 GN=PEX3 PE=1 SV=1
7	C4R6F0	4.93e-15	78.6	455	0.268	0.220	C4R6F0_KOMPG Peroxisomal biogenesis factor 3 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAS_chr3_1073 PE=3 SV=1
8	P28795	5.97e-06	50.4	441	0.102	0.086	PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX3 PE=1 SV=1
9	O14017	1.7	33.1	346	0.094	0.101	YDPE_SCHPO Uncharacterized protein C29A4.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29A4.14c PE=4 SV=3
10	P29704	2.2	32.7	444	0.094	0.079	ERG9_YEAST Squalene synthase ERG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG9 PE=1 SV=2
11	Q57Z60	2.6	32.7	4692	0.083	0.007	Q57Z60_TRYB2 Non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.474 PE=4 SV=1
12	Q8R2Q8	3.2	31.6	172	0.056	0.122	BST2_MOUSE Bone marrow stromal antigen 2 OS=Mus musculus OX=10090 GN=Bst2 PE=1 SV=1
13	Q9VQ54	5.0	32.0	1508	0.088	0.022	Q9VQ54_DROME FI05392p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=2
14	Q0E8U6	5.1	32.0	1504	0.088	0.022	Q0E8U6_DROME RE21455p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
15	A8DYT1	5.2	32.0	1539	0.088	0.021	A8DYT1_DROME WD repeat domain 62, isoform D OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
16	Q9VGD2	5.7	31.6	508	0.091	0.067	Q9VGD2_DROME Defective proboscis extension response 17, isoform B OS=Drosophila melanogaster OX=7227 GN=dpr17 PE=4 SV=2
17	M9PBP2	6.0	31.6	1476	0.059	0.015	M9PBP2_DROME WD repeat domain 62, isoform H OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
18	Q960J6	6.1	31.6	1183	0.088	0.028	Q960J6_DROME LD47622p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
19	Q0E8U7	6.4	31.6	2347	0.059	0.009	Q0E8U7_DROME WD repeat domain 62, isoform C OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
20	Q9VGD3	6.5	31.2	664	0.091	0.051	Q9VGD3_DROME Defective proboscis extension response 17, isoform A OS=Drosophila melanogaster OX=7227 GN=dpr17 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04882 Peroxin-3	7.3e-65	231.5	Peroxin-3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357051	0.999	Peroxisomal biogenesis factor 19
2	9606.ENSP00000241041	0.998	Peroxisomal membrane protein PEX16
3	9606.ENSP00000482609	0.994	Peroxisome assembly protein 12
4	9606.ENSP00000295030	0.993	Peroxisomal membrane protein PEX13
5	9606.ENSP00000390722	0.987	Peroxisomal membrane protein PMP34
6	9606.ENSP00000349543	0.979	Peroxisome biogenesis factor 2
7	9606.ENSP00000349016	0.971	Peroxisomal membrane protein PEX14
8	9606.ENSP00000359233	0.970	ATP-binding cassette sub-family D member 3
9	9606.ENSP00000358312	0.966	Peroxisomal membrane protein 11B
10	9606.ENSP00000300056	0.964	Peroxisomal membrane protein 11A
11	9606.ENSP00000391601	0.960	Peroxisomal targeting signal 1 receptor
12	9606.ENSP00000218104	0.953	ATP-binding cassette sub-family D member 1
13	9606.ENSP00000331106	0.947	Peroxisome assembly protein 26
14	9606.ENSP00000288774	0.942	Peroxisome biogenesis factor 10
15	9606.ENSP00000439012	0.934	Acyl-CoA-binding protein
16	9606.ENSP00000315680	0.927	Peroxisomal targeting signal 2 receptor
17	9606.ENSP00000303511	0.925	Peroxisome assembly factor 2
18	9606.ENSP00000223136	0.902	Mitochondrial fission 1 protein
19	9606.ENSP00000248633	0.901	Peroxisome biogenesis factor 1
20	9606.ENSP00000252486	0.900	Apolipoprotein E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.998	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.986	cellular component organization
GO:0051234	0.975	establishment of localization
GO:0006810	0.974	transport
GO:0033036	0.969	macromolecule localization
GO:0046907	0.963	intracellular transport
GO:0045184	0.961	establishment of protein localization
GO:0033365	0.949	protein localization to organelle
GO:0015031	0.948	protein transport
GO:0006996	0.933	organelle organization
GO:0006605	0.924	protein targeting
GO:0072594	0.914	establishment of protein localization to organelle
GO:0043574	0.912	peroxisomal transport
GO:0072662	0.863	protein localization to peroxisome
GO:0072663	0.835	establishment of protein localization to peroxisome
GO:0072657	0.762	protein localization to membrane
GO:0090150	0.754	establishment of protein localization to membrane
GO:0006625	0.714	protein targeting to peroxisome
GO:0015919	0.690	peroxisomal membrane transport
GO:0008152	0.386	metabolic process
GO:0006612	0.344	protein targeting to membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005778	1.000	peroxisomal membrane
GO:0012505	0.997	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0032991	0.991	protein-containing complex
GO:0005829	0.991	cytosol
GO:0005634	0.981	nucleus
GO:0031981	0.965	nuclear lumen
GO:0005783	0.964	endoplasmic reticulum
GO:0005654	0.961	nucleoplasm
GO:0032994	0.714	protein-lipid complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]