StarFunc result for job id P56703

User Input

>input (355 residues)
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31285	0.925	0.933	5.458E-59	352	0.854	0.861	P31285.pdb.gz	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1
2	AFDB:P27467	0.927	0.935	3.995E-56	352	0.820	0.827	P27467.pdb.gz	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
3	AFDB:A1DYI3	0.849	0.849	6.004E-55	355	0.938	0.938	A1DYI3.pdb.gz	A1DYI3_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt3 PE=2 SV=1
4	AFDB:F1QK98	0.847	0.824	9.978E-53	365	0.848	0.825	F1QK98.pdb.gz
5	AFDB:A0A1D5PX88	0.850	0.804	1.751E-52	376	0.820	0.774	A0A1D5PX88.pdb.gz
6	PDB:6ahyB	0.804	0.905	2.119E-48	313	0.882	1.000	6ahyB.pdb.gz
7	AFDB:P49337	0.867	0.876	4.085E-39	351	0.476	0.481	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
8	AFDB:Q92050	0.859	0.842	2.851E-38	363	0.459	0.449	Q92050.pdb.gz	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
9	AFDB:P22724	0.866	0.876	4.078E-38	351	0.485	0.490	P22724.pdb.gz	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
10	AFDB:B1WBR9	0.861	0.824	5.266E-38	372	0.462	0.441	B1WBR9.pdb.gz	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
11	AFDB:P22725	0.843	0.791	5.542E-38	380	0.451	0.421	P22725.pdb.gz	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
12	PDB:4f0aB	0.671	0.797	1.220E-24	294	0.330	0.398	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7c7sA	0.133	0.090	8.617E-1	685	0.056	0.029	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
14	PDB:6sb3A	0.072	0.046	1.057	604	0.014	0.008	6sb3A.pdb.gz
15	PDB:7qxaA	0.084	0.046	1.233	954	0.104	0.039	7qxaA.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
16	PDB:7wq3R	0.098	0.109	1.233	289	0.073	0.090	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
17	PDB:3b07B	0.083	0.105	1.675	270	0.003	0.004	3b07B.pdb.gz
18	PDB:7rpqA	0.083	0.103	2.055	258	0.023	0.031	7rpqA.pdb.gz
19	PDB:7f8xA	0.117	0.101	2.276	443	0.070	0.056	7f8xA.pdb.gz	Structures of the human cholecystokinin receptors bound to agonists and antagonists.
20	PDB:3upuA	0.054	0.045	2.522	439	0.020	0.016	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AN69	0.0	522	367	0.693	0.670	A0A8I6AN69_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt3 PE=3 SV=1
2	A1DYI3	0.0	721	355	0.961	0.961	A1DYI3_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt3 PE=2 SV=1
3	B0LK22	0.0	681	355	0.896	0.896	B0LK22_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt3 PE=2 SV=1
4	D3ZCR1	0.0	734	355	0.989	0.989	D3ZCR1_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt3 PE=3 SV=1
5	P17553	0.0	734	355	0.989	0.989	WNT3_MOUSE Proto-oncogene Wnt-3 OS=Mus musculus OX=10090 GN=Wnt3 PE=1 SV=1
6	P27467	0.0	633	352	0.831	0.838	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
7	P31285	0.0	659	352	0.862	0.869	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1
8	P56703	0.0	739	355	1.000	1.000	WNT3_HUMAN Proto-oncogene Wnt-3 OS=Homo sapiens OX=9606 GN=WNT3 PE=1 SV=2
9	P56704	0.0	636	352	0.837	0.844	WNT3A_HUMAN Protein Wnt-3a OS=Homo sapiens OX=9606 GN=WNT3A PE=1 SV=2
10	Q2LMP1	0.0	655	352	0.856	0.864	WNT3A_CHICK Protein Wnt-3a OS=Gallus gallus OX=9031 GN=WNT3A PE=1 SV=1
11	Q6IYD9	0.0	649	365	0.854	0.830	Q6IYD9_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=Zwnt[a] PE=2 SV=1
12	P56705	8.34e-116	341	351	0.476	0.481	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
13	P22724	1.57e-115	340	351	0.476	0.481	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
14	Q9QXQ5	6.90e-115	339	351	0.476	0.481	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
15	P49337	1.09e-112	333	351	0.470	0.476	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
16	P49338	2.17e-112	333	351	0.468	0.473	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
17	P47793	2.46e-111	330	352	0.462	0.466	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
18	Q92050	5.72e-107	319	363	0.454	0.444	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
19	P21552	4.93e-106	317	360	0.428	0.422	WNT2_MOUSE Protein Wnt-2 OS=Mus musculus OX=10090 GN=Wnt2 PE=2 SV=2
20	A0A0G2K3B7	7.88e-106	316	353	0.428	0.431	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	2e-120	413.6	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005949

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004278	0.955	Low-density lipoprotein receptor-related protein
2	61853.ENSNLEP00000023102	0.952	Frizzled class receptor 1
3	61853.ENSNLEP00000022623	0.950	Frizzled class receptor 7
4	61853.ENSNLEP00000017164	0.934	Protein Wnt
5	61853.ENSNLEP00000008691	0.930	Frizzled class receptor 5
6	61853.ENSNLEP00000014599	0.915	Dickkopf-like protein 1
7	61853.ENSNLEP00000019589	0.914	Frizzled class receptor 4
8	61853.ENSNLEP00000009526	0.911	Porcupine homolog (Drosophila)
9	61853.ENSNLEP00000004540	0.886	Frizzled class receptor 6
10	61853.ENSNLEP00000004478	0.883	Receptor-like tyrosine kinase
11	61853.ENSNLEP00000022578	0.851	Frizzled class receptor 9
12	61853.ENSNLEP00000003772	0.846	WNT inhibitory factor 1
13	61853.ENSNLEP00000007969	0.846	Low density lipoprotein receptor-related protein 5
14	61853.ENSNLEP00000015263	0.840	Secreted frizzled-related protein 1
15	61853.ENSNLEP00000020193	0.840	Frizzled class receptor 3
16	61853.ENSNLEP00000007261	0.837	Secreted frizzled-related protein 2
17	61853.ENSNLEP00000022579	0.836	Frizzled class receptor 10
18	61853.ENSNLEP00000006991	0.829	Catenin beta 1
19	61853.ENSNLEP00000003206	0.819	Secreted frizzled-related protein 4
20	61853.ENSNLEP00000011333	0.795	Wntless Wnt ligand secretion mediator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.996	receptor ligand activity
GO:0005109	0.975	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.990	multicellular organism development
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.981	response to stimulus
GO:0048731	0.960	system development
GO:0016055	0.957	Wnt signaling pathway
GO:0048513	0.943	animal organ development
GO:0048518	0.927	positive regulation of biological process
GO:0050793	0.904	regulation of developmental process
GO:0019222	0.882	regulation of metabolic process
GO:0048522	0.880	positive regulation of cellular process
GO:0060070	0.859	canonical Wnt signaling pathway
GO:0009653	0.856	anatomical structure morphogenesis
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0051171	0.796	regulation of nitrogen compound metabolic process
GO:0048869	0.793	cellular developmental process
GO:0080090	0.793	regulation of primary metabolic process
GO:0048519	0.791	negative regulation of biological process
GO:0031323	0.789	regulation of cellular metabolic process
GO:0010468	0.781	regulation of gene expression
GO:0009893	0.778	positive regulation of metabolic process
GO:0048736	0.774	appendage development
GO:0010604	0.773	positive regulation of macromolecule metabolic process
GO:0048523	0.757	negative regulation of cellular process
GO:0060173	0.719	limb development
GO:0030154	0.716	cell differentiation
GO:0009888	0.714	tissue development
GO:0051128	0.706	regulation of cellular component organization
GO:0045595	0.689	regulation of cell differentiation
GO:0048583	0.684	regulation of response to stimulus
GO:0010556	0.617	regulation of macromolecule biosynthetic process
GO:0019219	0.612	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.575	regulation of DNA-templated transcription
GO:0023051	0.540	regulation of signaling
GO:0010646	0.540	regulation of cell communication
GO:0001558	0.534	regulation of cell growth
GO:0009966	0.518	regulation of signal transduction
GO:0051239	0.498	regulation of multicellular organismal process
GO:0007399	0.463	nervous system development
GO:0042127	0.445	regulation of cell population proliferation
GO:0051173	0.436	positive regulation of nitrogen compound metabolic process
GO:0031325	0.435	positive regulation of cellular metabolic process
GO:0048584	0.389	positive regulation of response to stimulus
GO:0023056	0.380	positive regulation of signaling
GO:0010647	0.378	positive regulation of cell communication
GO:0006357	0.352	regulation of transcription by RNA polymerase II
GO:0009967	0.346	positive regulation of signal transduction
GO:0051254	0.320	positive regulation of RNA metabolic process
GO:0045893	0.311	positive regulation of DNA-templated transcription
GO:0030111	0.309	regulation of Wnt signaling pathway
GO:0071840	0.308	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0012505	0.994	endomembrane system
GO:0016020	0.975	membrane
GO:0005576	0.972	extracellular region
GO:0071944	0.967	cell periphery
GO:0032991	0.942	protein-containing complex
GO:0005886	0.909	plasma membrane
GO:0005783	0.879	endoplasmic reticulum
GO:0031090	0.808	organelle membrane
GO:0005615	0.788	extracellular space
GO:0031982	0.788	vesicle
GO:0005634	0.666	nucleus
GO:0031410	0.573	cytoplasmic vesicle
GO:0005788	0.544	endoplasmic reticulum lumen
GO:0031981	0.528	nuclear lumen
GO:0005794	0.418	Golgi apparatus
GO:0043230	0.397	extracellular organelle
GO:0030659	0.371	cytoplasmic vesicle membrane
GO:0030139	0.364	endocytic vesicle
GO:0005654	0.364	nucleoplasm
GO:0005829	0.341	cytosol
GO:0070062	0.341	extracellular exosome
GO:0031012	0.329	extracellular matrix
GO:0030666	0.328	endocytic vesicle membrane
GO:0005796	0.326	Golgi lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]