StarFunc result for job id P56704

User Input

>input (352 residues)
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27467	0.956	0.956	9.340E-59	352	0.960	0.960	P27467.pdb.gz	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
2	AFDB:P31285	0.971	0.971	1.180E-57	352	0.841	0.841	P31285.pdb.gz	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1
3	AFDB:F1QK98	0.858	0.828	2.484E-51	365	0.858	0.827	F1QK98.pdb.gz
4	AFDB:A0A1D5PX88	0.864	0.810	2.435E-50	376	0.821	0.769	A0A1D5PX88.pdb.gz
5	AFDB:A1DYI3	0.864	0.857	9.581E-50	355	0.835	0.828	A1DYI3.pdb.gz	A1DYI3_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt3 PE=2 SV=1
6	PDB:6ahyB	0.812	0.908	8.841E-44	313	0.778	0.875	6ahyB.pdb.gz
7	AFDB:Q98SN7	0.865	0.794	2.194E-37	385	0.440	0.403	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
8	AFDB:P09544	0.859	0.842	2.688E-37	360	0.435	0.425	P09544.pdb.gz	WNT2_HUMAN Protein Wnt-2 OS=Homo sapiens OX=9606 GN=WNT2 PE=2 SV=1
9	AFDB:P22724	0.885	0.887	3.293E-37	351	0.486	0.487	P22724.pdb.gz	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
10	AFDB:P24257	0.877	0.836	4.033E-37	370	0.466	0.443	P24257.pdb.gz	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
11	AFDB:P47793	0.882	0.882	4.464E-37	352	0.452	0.452	P47793.pdb.gz	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
12	PDB:4f0aB	0.687	0.810	2.014E-23	294	0.341	0.408	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7qxaA	0.093	0.050	9.927E-1	954	0.105	0.039	7qxaA.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
14	PDB:6brhB	0.137	0.105	1.279	502	0.062	0.044	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
15	PDB:5t04A	0.143	0.117	1.346	458	0.080	0.061	5t04A.pdb.gz	Structure and dynamics of a constitutively active neurotensin receptor.
16	PDB:7wq3R	0.118	0.132	2.020	289	0.091	0.111	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
17	PDB:4zbpB	0.087	0.108	2.235	270	0.017	0.022	4zbpB.pdb.gz	Crystal Structures of Arabidopsis thaliana Nudix Hydrolase NUDT7 Reveal a Previously Unobserved Conformation.
18	PDB:5e2qA	0.134	0.081	2.352	725	0.062	0.030	5e2qA.pdb.gz	Substrate complexes of human dipeptidyl peptidase III reveal the mechanism of enzyme inhibition.
19	PDB:6sb3A	0.053	0.036	2.352	604	0.017	0.010	6sb3A.pdb.gz
20	PDB:6ymwA	0.155	0.079	2.352	913	0.071	0.027	6ymwA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1DYI3	0.0	637	355	0.849	0.842	A1DYI3_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt3 PE=2 SV=1
2	B0LK22	0.0	630	355	0.832	0.825	B0LK22_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt3 PE=2 SV=1
3	D3ZCR1	0.0	631	355	0.830	0.823	D3ZCR1_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt3 PE=3 SV=1
4	P17553	0.0	631	355	0.830	0.823	WNT3_MOUSE Proto-oncogene Wnt-3 OS=Mus musculus OX=10090 GN=Wnt3 PE=1 SV=1
5	P27467	0.0	709	352	0.960	0.960	WNT3A_MOUSE Protein Wnt-3a OS=Mus musculus OX=10090 GN=Wnt3a PE=1 SV=1
6	P31285	0.0	641	352	0.841	0.841	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1
7	P56703	0.0	632	355	0.830	0.823	WNT3_HUMAN Proto-oncogene Wnt-3 OS=Homo sapiens OX=9606 GN=WNT3 PE=1 SV=2
8	P56704	0.0	733	352	1.000	1.000	WNT3A_HUMAN Protein Wnt-3a OS=Homo sapiens OX=9606 GN=WNT3A PE=1 SV=2
9	Q2LMP1	0.0	666	352	0.878	0.878	WNT3A_CHICK Protein Wnt-3a OS=Gallus gallus OX=9031 GN=WNT3A PE=1 SV=1
10	Q6IYD9	0.0	642	365	0.852	0.822	Q6IYD9_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=Zwnt[a] PE=2 SV=1
11	A0A8I6AN69	7.94e-166	469	367	0.616	0.591	A0A8I6AN69_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt3 PE=3 SV=1
12	P56705	2.33e-113	335	351	0.469	0.470	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
13	P22724	7.97e-113	333	351	0.469	0.470	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
14	Q9QXQ5	1.47e-112	333	351	0.469	0.470	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
15	P49337	1.57e-110	328	351	0.463	0.464	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
16	P49338	3.20e-109	324	351	0.452	0.453	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
17	Q9H1J7	8.80e-109	323	359	0.460	0.451	WNT5B_HUMAN Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2
18	P47793	8.74e-108	321	352	0.452	0.452	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
19	Q3L255	9.64e-108	321	359	0.449	0.440	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
20	P24257	3.74e-107	320	370	0.466	0.443	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	1.4e-118	407.5	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284523

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261349	0.999	Low-density lipoprotein receptor-related protein 6
2	9606.ENSP00000287934	0.998	Frizzled-1
3	9606.ENSP00000294304	0.998	Low-density lipoprotein receptor-related protein 5
4	9606.ENSP00000323901	0.998	Frizzled-2
5	9606.ENSP00000363826	0.998	Frizzled-8
6	9606.ENSP00000354607	0.993	Frizzled-5
7	9606.ENSP00000344456	0.991	Catenin beta-1
8	9606.ENSP00000363081	0.988	Dickkopf-related protein 1
9	9606.ENSP00000262320	0.985	Axin-1
10	9606.ENSP00000005340	0.984	Segment polarity protein dishevelled homolog DVL-2
11	9606.ENSP00000478721	0.984	Tyrosine-protein kinase RYK
12	9606.ENSP00000324806	0.983	Glycogen synthase kinase-3 beta
13	9606.ENSP00000368169	0.981	Segment polarity protein dishevelled homolog DVL-1
14	9606.ENSP00000322304	0.980	Protein-serine O-palmitoleoyltransferase porcupine
15	9606.ENSP00000351605	0.976	Frizzled-6
16	9606.ENSP00000316054	0.974	Segment polarity protein dishevelled homolog DVL-3
17	9606.ENSP00000364860	0.972	Tyrosine-protein kinase transmembrane receptor ROR2
18	9606.ENSP00000286574	0.965	Wnt inhibitory factor 1
19	9606.ENSP00000301691	0.965	Sclerostin
20	9606.ENSP00000257430	0.962	Adenomatous polyposis coli protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.999	receptor ligand activity
GO:0001664	0.876	G protein-coupled receptor binding
GO:0005109	0.856	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0032502	0.986	developmental process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.983	anatomical structure development
GO:0060070	0.979	canonical Wnt signaling pathway
GO:0048518	0.976	positive regulation of biological process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0010604	0.964	positive regulation of macromolecule metabolic process
GO:0007275	0.960	multicellular organism development
GO:0050793	0.958	regulation of developmental process
GO:0048522	0.951	positive regulation of cellular process
GO:0010468	0.948	regulation of gene expression
GO:0019219	0.940	regulation of nucleobase-containing compound metabolic process
GO:0048731	0.931	system development
GO:0048583	0.930	regulation of response to stimulus
GO:0045595	0.929	regulation of cell differentiation
GO:0031326	0.922	regulation of cellular biosynthetic process
GO:0010556	0.918	regulation of macromolecule biosynthetic process
GO:0031325	0.904	positive regulation of cellular metabolic process
GO:0048513	0.888	animal organ development
GO:0030111	0.887	regulation of Wnt signaling pathway
GO:0051252	0.880	regulation of RNA metabolic process
GO:0048869	0.876	cellular developmental process
GO:0006355	0.862	regulation of DNA-templated transcription
GO:0009888	0.857	tissue development
GO:0051128	0.856	regulation of cellular component organization
GO:0007399	0.856	nervous system development
GO:0009653	0.851	anatomical structure morphogenesis
GO:0030154	0.851	cell differentiation
GO:0044093	0.849	positive regulation of molecular function
GO:0048519	0.833	negative regulation of biological process
GO:0051094	0.827	positive regulation of developmental process
GO:0009967	0.823	positive regulation of signal transduction
GO:0030901	0.799	midbrain development
GO:0051173	0.791	positive regulation of nitrogen compound metabolic process
GO:0009891	0.787	positive regulation of biosynthetic process
GO:0045597	0.768	positive regulation of cell differentiation
GO:0048523	0.762	negative regulation of cellular process
GO:0050678	0.759	regulation of epithelial cell proliferation
GO:0051090	0.756	regulation of DNA-binding transcription factor activity
GO:0008284	0.754	positive regulation of cell population proliferation
GO:0045596	0.752	negative regulation of cell differentiation
GO:0031328	0.737	positive regulation of cellular biosynthetic process
GO:0010628	0.728	positive regulation of gene expression
GO:0071840	0.726	cellular component organization or biogenesis
GO:0016043	0.717	cellular component organization
GO:2000026	0.715	regulation of multicellular organismal development
GO:0051091	0.673	positive regulation of DNA-binding transcription factor activity
GO:0050679	0.666	positive regulation of epithelial cell proliferation
GO:0040008	0.660	regulation of growth
GO:0010557	0.656	positive regulation of macromolecule biosynthetic process
GO:0045935	0.655	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.651	positive regulation of RNA metabolic process
GO:0060429	0.637	epithelium development
GO:0051240	0.637	positive regulation of multicellular organismal process
GO:0030900	0.635	forebrain development
GO:0009887	0.609	animal organ morphogenesis
GO:0065008	0.602	regulation of biological quality
GO:0035295	0.592	tube development
GO:0022603	0.575	regulation of anatomical structure morphogenesis
GO:0045165	0.571	cell fate commitment
GO:0051130	0.536	positive regulation of cellular component organization
GO:0009953	0.535	dorsal/ventral pattern formation
GO:1903508	0.535	positive regulation of nucleic acid-templated transcription
GO:0045893	0.517	positive regulation of DNA-templated transcription
GO:0030182	0.475	neuron differentiation
GO:0009790	0.470	embryo development
GO:0048598	0.349	embryonic morphogenesis
GO:0048568	0.345	embryonic organ development
GO:0051246	0.312	regulation of protein metabolic process
GO:0006357	0.312	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005576	0.988	extracellular region
GO:0070013	0.986	intracellular organelle lumen
GO:0016020	0.974	membrane
GO:0071944	0.969	cell periphery
GO:0032991	0.963	protein-containing complex
GO:0005886	0.925	plasma membrane
GO:0005783	0.891	endoplasmic reticulum
GO:0031982	0.874	vesicle
GO:0031090	0.827	organelle membrane
GO:0005615	0.796	extracellular space
GO:0005634	0.751	nucleus
GO:0005788	0.703	endoplasmic reticulum lumen
GO:0005829	0.668	cytosol
GO:0031410	0.596	cytoplasmic vesicle
GO:0031981	0.520	nuclear lumen
GO:0005794	0.457	Golgi apparatus
GO:0030659	0.427	cytoplasmic vesicle membrane
GO:0098588	0.395	bounding membrane of organelle
GO:0030139	0.390	endocytic vesicle
GO:0030666	0.339	endocytic vesicle membrane
GO:1903561	0.329	extracellular vesicle
GO:0005654	0.320	nucleoplasm
GO:0070062	0.302	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]