StarFunc result for job id P56705

User Input

>input (351 residues)
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22724	0.995	0.995	2.684E-62	351	0.989	0.989	P22724.pdb.gz	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
2	AFDB:P49337	0.989	0.989	2.268E-58	351	0.855	0.855	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
3	AFDB:P47793	0.956	0.953	2.499E-56	352	0.826	0.824	P47793.pdb.gz	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
4	AFDB:A0A0B5JQ72	0.948	0.930	2.742E-45	358	0.632	0.620	A0A0B5JQ72.pdb.gz
5	AFDB:Q98SN7	0.872	0.798	1.030E-38	385	0.490	0.447	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
6	AFDB:Q93097	0.835	0.752	3.049E-38	391	0.476	0.427	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
7	AFDB:B3DFK5	0.855	0.777	4.157E-38	387	0.479	0.434	B3DFK5.pdb.gz
8	AFDB:B0S7E3	0.844	0.751	1.054E-37	396	0.479	0.424	B0S7E3.pdb.gz
9	AFDB:P22725	0.889	0.825	1.054E-37	380	0.490	0.453	P22725.pdb.gz	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
10	AFDB:P31285	0.881	0.879	1.860E-37	352	0.464	0.463	P31285.pdb.gz	WNT3A_XENLA Protein Wnt-3a OS=Xenopus laevis OX=8355 GN=wnt3a PE=1 SV=1
11	PDB:6ahyB	0.754	0.840	3.872E-32	313	0.453	0.508	6ahyB.pdb.gz
12	PDB:4f0aB	0.663	0.780	1.830E-24	294	0.368	0.439	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6ymvA	0.101	0.056	5.712E-1	887	0.083	0.033	6ymvA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
14	PDB:5e2qA	0.141	0.082	1.118	725	0.068	0.033	5e2qA.pdb.gz	Substrate complexes of human dipeptidyl peptidase III reveal the mechanism of enzyme inhibition.
15	PDB:7pzyG	0.096	0.135	1.525	206	0.043	0.073	7pzyG.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:7jq9A	0.099	0.029	1.691	2427	0.048	0.007	7jq9A.pdb.gz
17	PDB:6sb3A	0.073	0.045	1.780	604	0.017	0.010	6sb3A.pdb.gz
18	PDB:6ymwA	0.167	0.091	2.079	913	0.083	0.032	6ymwA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
19	PDB:7v3u6	0.087	0.058	2.427	646	0.057	0.031	7v3u6.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
20	PDB:3b07B	0.081	0.101	2.556	270	0.006	0.007	3b07B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22724	0.0	716	351	0.989	0.989	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
2	P47793	0.0	625	352	0.826	0.824	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
3	P49337	0.0	636	351	0.855	0.855	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
4	P49338	0.0	643	351	0.855	0.855	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
5	P56705	0.0	722	351	1.000	1.000	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
6	Q9QXQ5	0.0	712	351	0.983	0.983	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
7	Q9IAU3	8.30e-153	435	358	0.610	0.598	Q9IAU3_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt4b PE=2 SV=1
8	Q98SN7	1.44e-120	355	385	0.490	0.447	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
9	Q3L254	2.46e-117	345	349	0.481	0.484	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
10	P41221	3.34e-117	346	380	0.496	0.458	WNT5A_HUMAN Protein Wnt-5a OS=Homo sapiens OX=9606 GN=WNT5A PE=1 SV=2
11	Q9QXQ7	6.86e-117	345	380	0.496	0.458	WNT5A_RAT Protein Wnt-5a OS=Rattus norvegicus OX=10116 GN=Wnt5a PE=2 SV=2
12	P22725	7.81e-117	345	380	0.496	0.458	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
13	P56706	8.80e-117	343	349	0.484	0.487	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
14	A1DYI3	1.06e-116	343	355	0.487	0.482	A1DYI3_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt3 PE=2 SV=1
15	Q8AY89	2.02e-116	344	387	0.467	0.424	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
16	P28047	2.20e-116	342	349	0.481	0.484	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
17	Q5NSW6	2.20e-116	342	349	0.481	0.484	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
18	D3ZCR1	2.60e-116	343	355	0.481	0.476	D3ZCR1_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt3 PE=3 SV=1
19	P17553	2.60e-116	343	355	0.481	0.476	WNT3_MOUSE Proto-oncogene Wnt-3 OS=Mus musculus OX=10090 GN=Wnt3 PE=1 SV=1
20	P56703	6.42e-116	342	355	0.481	0.476	WNT3_HUMAN Proto-oncogene Wnt-3 OS=Homo sapiens OX=9606 GN=WNT3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09047 MEF2_binding	8.3e+02	11.3	MEF2 binding
2	PF00110 wnt	9.3e-126	431.1	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007459267.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007466213.1	0.972	Belongs to the G-protein coupled receptor Fz/Smo family.
2	118797.XP_007465371.1	0.957	Belongs to the G-protein coupled receptor Fz/Smo family.
3	118797.XP_007452122.1	0.936	Belongs to the G-protein coupled receptor Fz/Smo family.
4	118797.XP_007452311.1	0.936	Ligand for members of the frizzled family of seven transmembrane receptors
5	118797.XP_007450468.1	0.932	Low-density lipoprotein receptor-related protein 5
6	118797.XP_007447445.1	0.916	Wnt inhibitory factor 1
7	118797.XP_007469399.1	0.913	Low-density lipoprotein receptor-related protein 6 isoform X1
8	118797.XP_007469246.1	0.912	Belongs to the G-protein coupled receptor Fz/Smo family.
9	118797.XP_007455182.1	0.907	Belongs to the G-protein coupled receptor Fz/Smo family.
10	118797.XP_007448903.1	0.897	Belongs to the G-protein coupled receptor Fz/Smo family.
11	118797.XP_007450927.1	0.894	Belongs to the membrane-bound acyltransferase family.
12	118797.XP_007468848.1	0.885	Belongs to the G-protein coupled receptor Fz/Smo family.
13	118797.XP_007470346.1	0.870	Dickkopf WNT signaling pathway inhibitor 1
14	118797.XP_007472101.1	0.869	Belongs to the G-protein coupled receptor Fz/Smo family.
15	118797.XP_007455544.1	0.855	Secreted frizzled-related protein 1
16	118797.XP_007445933.1	0.854	Belongs to the G-protein coupled receptor Fz/Smo family.
17	118797.XP_007463716.1	0.854	Belongs to the G-protein coupled receptor Fz/Smo family.
18	118797.XP_007466783.1	0.851	Secreted frizzled related protein 2
19	118797.XP_007457617.1	0.845	Receptor-like tyrosine kinase
20	118797.XP_007460174.1	0.845	Wntless Wnt ligand secretion mediator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0048018	0.988	receptor ligand activity
GO:0001664	0.899	G protein-coupled receptor binding
GO:0005109	0.886	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0009987	0.986	cellular process
GO:0048856	0.986	anatomical structure development
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.983	multicellular organismal process
GO:0019222	0.978	regulation of metabolic process
GO:0048518	0.977	positive regulation of biological process
GO:0051716	0.974	cellular response to stimulus
GO:0048519	0.974	negative regulation of biological process
GO:0007154	0.970	cell communication
GO:0050793	0.970	regulation of developmental process
GO:0007275	0.968	multicellular organism development
GO:0080090	0.965	regulation of primary metabolic process
GO:0048522	0.957	positive regulation of cellular process
GO:0048731	0.955	system development
GO:0007165	0.955	signal transduction
GO:0007267	0.953	cell-cell signaling
GO:0007166	0.952	cell surface receptor signaling pathway
GO:0030154	0.945	cell differentiation
GO:0048513	0.933	animal organ development
GO:0051094	0.926	positive regulation of developmental process
GO:0048523	0.916	negative regulation of cellular process
GO:0007548	0.914	sex differentiation
GO:0009893	0.901	positive regulation of metabolic process
GO:0051252	0.895	regulation of RNA metabolic process
GO:0009888	0.891	tissue development
GO:1903506	0.890	regulation of nucleic acid-templated transcription
GO:0009653	0.881	anatomical structure morphogenesis
GO:0051239	0.862	regulation of multicellular organismal process
GO:0198738	0.856	cell-cell signaling by wnt
GO:1905114	0.856	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0006355	0.849	regulation of DNA-templated transcription
GO:0022603	0.847	regulation of anatomical structure morphogenesis
GO:0016055	0.845	Wnt signaling pathway
GO:0060070	0.835	canonical Wnt signaling pathway
GO:0010604	0.823	positive regulation of macromolecule metabolic process
GO:0071363	0.815	cellular response to growth factor stimulus
GO:0051173	0.810	positive regulation of nitrogen compound metabolic process
GO:0061458	0.809	reproductive system development
GO:0045935	0.795	positive regulation of nucleobase-containing compound metabolic process
GO:0042127	0.781	regulation of cell population proliferation
GO:0009892	0.771	negative regulation of metabolic process
GO:0045137	0.763	development of primary sexual characteristics
GO:0060429	0.760	epithelium development
GO:0045597	0.751	positive regulation of cell differentiation
GO:0008406	0.735	gonad development
GO:0051240	0.726	positive regulation of multicellular organismal process
GO:0046546	0.722	development of primary male sexual characteristics
GO:0070169	0.716	positive regulation of biomineral tissue development
GO:0035239	0.711	tube morphogenesis
GO:0051128	0.708	regulation of cellular component organization
GO:0031328	0.704	positive regulation of cellular biosynthetic process
GO:0042221	0.699	response to chemical
GO:0008584	0.686	male gonad development
GO:0048583	0.682	regulation of response to stimulus
GO:0072009	0.676	nephron epithelium development
GO:0072080	0.666	nephron tubule development
GO:0010557	0.656	positive regulation of macromolecule biosynthetic process
GO:0051254	0.656	positive regulation of RNA metabolic process
GO:0070887	0.653	cellular response to chemical stimulus
GO:0010033	0.650	response to organic substance
GO:1902680	0.649	positive regulation of RNA biosynthetic process
GO:0060322	0.648	head development
GO:0007399	0.647	nervous system development
GO:0010605	0.616	negative regulation of macromolecule metabolic process
GO:0045995	0.615	regulation of embryonic development
GO:0030879	0.602	mammary gland development
GO:0009890	0.599	negative regulation of biosynthetic process
GO:0065008	0.597	regulation of biological quality
GO:1901700	0.597	response to oxygen-containing compound
GO:0009887	0.586	animal organ morphogenesis
GO:0007417	0.583	central nervous system development
GO:0023051	0.577	regulation of signaling
GO:0010646	0.577	regulation of cell communication
GO:1905330	0.566	regulation of morphogenesis of an epithelium
GO:1905332	0.549	positive regulation of morphogenesis of an epithelium
GO:1903508	0.548	positive regulation of nucleic acid-templated transcription
GO:0061180	0.547	mammary gland epithelium development
GO:0002009	0.543	morphogenesis of an epithelium
GO:0007420	0.535	brain development
GO:0045893	0.535	positive regulation of DNA-templated transcription
GO:0033993	0.522	response to lipid
GO:0044087	0.494	regulation of cellular component biogenesis
GO:0009966	0.467	regulation of signal transduction
GO:0033043	0.466	regulation of organelle organization
GO:0065009	0.442	regulation of molecular function
GO:0048584	0.372	positive regulation of response to stimulus
GO:0023056	0.366	positive regulation of signaling
GO:0010647	0.366	positive regulation of cell communication
GO:0030900	0.359	forebrain development
GO:0009967	0.317	positive regulation of signal transduction
GO:0006357	0.304	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005576	0.998	extracellular region
GO:0071944	0.993	cell periphery
GO:0070013	0.987	intracellular organelle lumen
GO:0005886	0.979	plasma membrane
GO:0005615	0.924	extracellular space
GO:0005783	0.911	endoplasmic reticulum
GO:0031982	0.882	vesicle
GO:0005788	0.852	endoplasmic reticulum lumen
GO:0005794	0.833	Golgi apparatus
GO:0031090	0.824	organelle membrane
GO:0031410	0.732	cytoplasmic vesicle
GO:0098588	0.465	bounding membrane of organelle
GO:0031981	0.453	nuclear lumen
GO:0065010	0.425	extracellular membrane-bounded organelle
GO:1903561	0.424	extracellular vesicle
GO:0031012	0.421	extracellular matrix
GO:0009986	0.386	cell surface
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]