StarFunc result for job id P56706

User Input

>input (349 residues)
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3L254	0.961	0.961	7.609E-61	349	0.954	0.954	Q3L254.pdb.gz	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
2	AFDB:A0A0G2K3B7	0.894	0.884	6.729E-58	353	0.923	0.912	A0A0G2K3B7.pdb.gz	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
3	AFDB:M0R9D3	0.883	0.883	9.648E-53	349	0.779	0.779	M0R9D3.pdb.gz	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
4	AFDB:P28465	0.902	0.895	1.082E-41	352	0.481	0.477	P28465.pdb.gz	WNT2_DROME Protein Wnt-2 OS=Drosophila melanogaster OX=7227 GN=Wnt2 PE=2 SV=2
5	AFDB:B0S7E3	0.842	0.746	4.449E-38	396	0.479	0.422	B0S7E3.pdb.gz
6	AFDB:F1QK98	0.830	0.795	1.506E-37	365	0.444	0.425	F1QK98.pdb.gz
7	AFDB:B3DFK5	0.835	0.757	1.588E-37	387	0.484	0.437	B3DFK5.pdb.gz
8	AFDB:Q93097	0.824	0.739	2.426E-37	391	0.493	0.440	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
9	AFDB:A0A1D5PX88	0.839	0.780	3.334E-37	376	0.433	0.402	A0A1D5PX88.pdb.gz
10	AFDB:Q92048	0.824	0.822	6.641E-37	350	0.441	0.440	Q92048.pdb.gz	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
11	PDB:6ahyB	0.818	0.907	3.523E-34	313	0.433	0.482	6ahyB.pdb.gz
12	PDB:4f0aB	0.693	0.817	4.467E-26	294	0.318	0.378	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6u23A	0.083	0.054	8.000E-1	583	0.057	0.034	6u23A.pdb.gz
14	PDB:3b07B	0.086	0.108	9.889E-1	270	0.006	0.007	3b07B.pdb.gz
15	PDB:6sb3A	0.068	0.042	1.043	604	0.017	0.010	6sb3A.pdb.gz
16	PDB:4w8yA	0.153	0.071	1.433	835	0.040	0.017	4w8yA.pdb.gz	Structural Model of a CRISPR RNA-Silencing Complex Reveals the RNA-Target Cleavage Activity in Cmr4.
17	PDB:3zqqC	0.094	0.191	1.511	134	0.040	0.104	3zqqC.pdb.gz
18	PDB:4v6wCP	0.061	0.097	1.511	185	0.017	0.032	4v6wCP.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:8a1dA	0.082	0.056	1.868	533	0.017	0.011	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
20	PDB:5aj0AP	0.062	0.126	2.077	153	0.009	0.020	5aj0AP.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3B7	0.0	673	353	0.923	0.912	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
2	M0R9D3	0.0	594	349	0.779	0.779	M0R9D3_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7a PE=3 SV=1
3	O00755	0.0	594	349	0.779	0.779	WNT7A_HUMAN Protein Wnt-7a OS=Homo sapiens OX=9606 GN=WNT7A PE=1 SV=2
4	P24383	0.0	594	349	0.779	0.779	WNT7A_MOUSE Protein Wnt-7a OS=Mus musculus OX=10090 GN=Wnt7a PE=1 SV=2
5	P28047	0.0	723	349	0.991	0.991	WNT7B_MOUSE Protein Wnt-7b OS=Mus musculus OX=10090 GN=Wnt7b PE=1 SV=1
6	P56706	0.0	727	349	1.000	1.000	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
7	Q3L254	0.0	706	349	0.954	0.954	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
8	Q5NSW6	0.0	723	349	0.991	0.991	Q5NSW6_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=2 SV=1
9	Q9DEB8	0.0	612	349	0.799	0.799	Q9DEB8_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT7A PE=2 SV=1
10	Q98SN7	7.35e-117	345	385	0.487	0.442	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
11	P56705	8.75e-117	343	351	0.487	0.484	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
12	P22724	6.36e-116	341	351	0.484	0.481	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1
13	Q9QXQ5	1.05e-115	341	351	0.481	0.479	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
14	Q93097	1.60e-115	342	391	0.481	0.430	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
15	O70283	2.58e-115	341	389	0.481	0.432	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
16	Q3L255	9.31e-115	338	359	0.458	0.446	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
17	Q8AY89	2.18e-114	339	387	0.476	0.429	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
18	Q9H1J7	2.94e-113	335	359	0.461	0.448	WNT5B_HUMAN Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2
19	P49338	1.19e-112	333	351	0.470	0.467	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1
20	P22726	1.24e-112	333	359	0.453	0.440	WNT5B_MOUSE Protein Wnt-5b OS=Mus musculus OX=10090 GN=Wnt5b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	5.9e-121	415.3	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001636

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005238	0.956	Low density lipoprotein receptor-related protein 5
2	60711.ENSCSAP00000018633	0.947	Frizzled class receptor 1
3	60711.ENSCSAP00000018469	0.918	Frizzled class receptor 10
4	60711.ENSCSAP00000014421	0.916	Frizzled class receptor 4
5	60711.ENSCSAP00000004889	0.910	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
6	60711.ENSCSAP00000018291	0.900	Frizzled class receptor 5
7	60711.ENSCSAP00000018988	0.883	Frizzled class receptor 9
8	60711.ENSCSAP00000018534	0.879	Frizzled class receptor 2
9	60711.ENSCSAP00000018288	0.864	Frizzled class receptor 7
10	60711.ENSCSAP00000000755	0.850	WNT inhibitory factor 1
11	60711.ENSCSAP00000011198	0.848	Secreted frizzled-related protein 1
12	60711.ENSCSAP00000011986	0.847	Frizzled class receptor 3
13	60711.ENSCSAP00000011185	0.841	Secreted frizzled-related protein 4
14	60711.ENSCSAP00000014767	0.841	Secreted frizzled-related protein 2
15	60711.ENSCSAP00000008099	0.838	Frizzled class receptor 6
16	60711.ENSCSAP00000002128	0.828	Secreted frizzled-related protein 5
17	60711.ENSCSAP00000003323	0.820	Dickkopf WNT signaling pathway inhibitor 1
18	60711.ENSCSAP00000011136	0.757	Dickkopf WNT signaling pathway inhibitor 4
19	60711.ENSCSAP00000000341	0.750	Dickkopf WNT signaling pathway inhibitor 2
20	60711.ENSCSAP00000016649	0.743	Wntless Wnt ligand secretion mediator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005109	1.000	frizzled binding
GO:0048018	1.000	receptor ligand activity
GO:0042056	0.327	chemoattractant activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.990	anatomical structure development
GO:0032501	0.989	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0050896	0.983	response to stimulus
GO:0050794	0.982	regulation of cellular process
GO:0048731	0.975	system development
GO:0048513	0.957	animal organ development
GO:0016055	0.947	Wnt signaling pathway
GO:0048518	0.925	positive regulation of biological process
GO:0007399	0.920	nervous system development
GO:0010646	0.918	regulation of cell communication
GO:0023051	0.914	regulation of signaling
GO:0009653	0.912	anatomical structure morphogenesis
GO:0048522	0.898	positive regulation of cellular process
GO:0030154	0.887	cell differentiation
GO:0009888	0.885	tissue development
GO:0060070	0.881	canonical Wnt signaling pathway
GO:0019222	0.864	regulation of metabolic process
GO:0070302	0.856	regulation of stress-activated protein kinase signaling cascade
GO:0060255	0.848	regulation of macromolecule metabolic process
GO:0008283	0.840	cell population proliferation
GO:0043408	0.789	regulation of MAPK cascade
GO:0009967	0.769	positive regulation of signal transduction
GO:0048519	0.758	negative regulation of biological process
GO:0071840	0.748	cellular component organization or biogenesis
GO:0030182	0.745	neuron differentiation
GO:0016043	0.739	cellular component organization
GO:0042221	0.722	response to chemical
GO:0010468	0.682	regulation of gene expression
GO:0009893	0.667	positive regulation of metabolic process
GO:0009719	0.657	response to endogenous stimulus
GO:0048523	0.632	negative regulation of cellular process
GO:0048666	0.629	neuron development
GO:0060429	0.627	epithelium development
GO:0010604	0.626	positive regulation of macromolecule metabolic process
GO:0031323	0.619	regulation of cellular metabolic process
GO:0065008	0.610	regulation of biological quality
GO:0010033	0.604	response to organic substance
GO:0032990	0.560	cell part morphogenesis
GO:0080090	0.544	regulation of primary metabolic process
GO:0051171	0.544	regulation of nitrogen compound metabolic process
GO:0120036	0.532	plasma membrane bounded cell projection organization
GO:1902533	0.510	positive regulation of intracellular signal transduction
GO:0009889	0.478	regulation of biosynthetic process
GO:0019219	0.474	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.468	regulation of cellular biosynthetic process
GO:0032872	0.460	regulation of stress-activated MAPK cascade
GO:0031325	0.445	positive regulation of cellular metabolic process
GO:0031175	0.444	neuron projection development
GO:0033993	0.443	response to lipid
GO:0042127	0.434	regulation of cell population proliferation
GO:0000902	0.417	cell morphogenesis
GO:0010556	0.417	regulation of macromolecule biosynthetic process
GO:0050793	0.416	regulation of developmental process
GO:0051173	0.416	positive regulation of nitrogen compound metabolic process
GO:0051252	0.394	regulation of RNA metabolic process
GO:0051239	0.387	regulation of multicellular organismal process
GO:2001141	0.369	regulation of RNA biosynthetic process
GO:0043410	0.349	positive regulation of MAPK cascade
GO:0006355	0.336	regulation of DNA-templated transcription
GO:0070304	0.326	positive regulation of stress-activated protein kinase signaling cascade
GO:0045935	0.313	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.309	positive regulation of biosynthetic process
GO:0031328	0.301	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0071944	0.997	cell periphery
GO:0005576	0.997	extracellular region
GO:0070013	0.997	intracellular organelle lumen
GO:0016020	0.994	membrane
GO:0012505	0.993	endomembrane system
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005615	0.967	extracellular space
GO:0005886	0.965	plasma membrane
GO:0031982	0.897	vesicle
GO:0031090	0.649	organelle membrane
GO:0031410	0.542	cytoplasmic vesicle
GO:0005783	0.515	endoplasmic reticulum
GO:0005788	0.480	endoplasmic reticulum lumen
GO:0031981	0.460	nuclear lumen
GO:1903561	0.410	extracellular vesicle
GO:0098588	0.408	bounding membrane of organelle
GO:0012506	0.365	vesicle membrane
GO:0070062	0.360	extracellular exosome
GO:0030659	0.360	cytoplasmic vesicle membrane
GO:0030139	0.352	endocytic vesicle
GO:0030666	0.336	endocytic vesicle membrane
GO:0005654	0.321	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]