StarFunc result for job id P56715

User Input

>input (2156 residues)
MSDTPSTGFSIIHPTSSEGQVPPPRHLSLTHPVVAKRISFYKSGDPQFGGVRVVVNPRSF
KSFDALLDNLSRKVPLPFGVRNISTPRGRHSITRLEELEDGESYLCSHGRKVQPVDLDKA
RRRPRPWLSSRAISAHSPPHPVAVAAPGMPRPPRSLVVFRNGDPKTRRAVLLSRRVTQSF
EAFLQHLTEVMQRPVVKLYATDGRRVPSLQAVILSSGAVVAAGREPFKPGNYDIQKYLLP
ARLPGISQRVYPKGNAKSESRKISTHMSSSSRSQIYSVSSEKTHNNDCYLDYSFVPEKYL
ALEKNDSQNLPIYPSEDDIEKSIIFNQDGTMTVEMKVRFRIKEEETIKWTTTVSKTGPSN
NDEKSEMSFPGRTESRSSGLKLAACSFSADVSPMERSSNQEGSLAEEINIQMTDQVAETC
SSASWENATVDTDIIQGTQDQAKHRFYRPPTPGLRRVRQKKSVIGSVTLVSETEVQEKMI
GQFSYSEERESGENKSEYHMFTHSCSKMSSVSNKPVLVQINNNDQMEESSLERKKENSLL
KSSAISAGVIEITSQKMLEMSHNNGLPSTISNNSIVEEDVVDCVVLDNKTGIKNFKTYGN
TNDRFSPISADATHFSSNNSGTDKNISEAPASEASSTVTARIDRLINEFAQCGLTKLPKN
EKKILSSVASKKKKKSRQQAINSRYQDGQLATKGILNKNERINTKGRITKEMIVQDSDSP
LKGGILCEEDLQKSDTVIESNTFCSKSNLNSTISKNFHRNKLNTTQNSKVQGLLTKRKSR
SLNKISLGAPKKREIGQRDKVFPHNESKYCKSTFENKSLFHVFNILEQKPKDFYAPQSQA
EVASGYLRGMAKKSLVSKVTDSHITLKSQKKRKGDKVKASAILSKQHATTRANSLASLKK
PDFPEAIAHHSIQNYIQSWLQNINPYPTLKPIKSAPVCRNETSVVNCSNNSFSGNDPHTN
SGKISNFVMESNKHITKIAGLTGDNLCKEGDKSFIANDTGEEDLHETQVGSLNDAYLVPL
HEHCTLSQSAINDHNTKSHIAAEKSGPEKKLVYQEINLARKRQSVEAAIQVDPIEEETPK
DLLPVLMLHQLQASVPGIHKTQNGVVQMPGSLAGVPFHSAICNSSTNLLLAWLLVLNLKG
SMNSFCQVDAHKATNKSSETLALLEILKHIAITEEADDLKAAVANLVESTTSHFGLSEKE
QDMVPIDLSANCSTVNIQSVPKCSENERTQGISSLDGGCSASEACAPEVCVLEVTCSPCE
MCTVNKAYSPKETCNPSDTFFPSDGYGVDQTSMNKACFLGEVCSLTDTVFSDKACAQKEN
HTYEGACPIDETYVPVNVCNTIDFLNSKENTYTDNLDSTEELERGDDIQKDLNILTDPEY
KNGFNTLVSHQNVSNLSSCGLCLSEKEAELDKKHSSLDDFENCSLRKFQDENAYTSFDME
EPRTSEEPGSITNSMTSSERNISELESFEELENHDTDIFNTVVNGGEQATEELIQEEVEA
SKTLELIDISSKNIMEEKRMNGIIYEIISKRLATPPSLDFCYDSKQNSEKETNEGETKMV
KMMVKTMETGSYSESSPDLKKCIKSPVTSDWSDYRPDSDSEQPYKTSSDDPNDSGELTQE
KEYNIGFVKRAIEKLYGKADIIKPSFFPGSTRKSQVCPYNSVEFQCSRKASLYDSEGQSF
GSSEQVSSSSSMLQEFQEERQDKCDVSAVRDNYCRGDIVEPGTKQNDDSRILTDIEEGVL
IDKGKWLLKENHLLRMSSENPGMCGNADTTSVDTLLDNNSSEVPYSHFGNLAPGPTMDEL
SSSELEELTQPLELKCNYFNMPHGSDSEPFHEDLLDVRNETCAKERIANHHTEEKGSHQS
ERVCTSVTHSFISAGNKVYPVSDDAIKNQPLPGSNMIHGTLQEADSLDKLYALCGQHCPI
LTVIIQPMNEEDRGFAYRKESDIENFLGFYLWMKIHPYLLQTDKNVFREENNKASMRQNL
IDNAIGDIFDQFYFSNTFDLMGKRRKQKRINFLGLEEEGNLKKFQPDLKERFCMNFLHTS
LLVVGNVDSNTQDLSGQTNEIFKAVDENNNLLNNRFQGSRTNLNQVVRENINCHYFFEML
GQACLLDICQVETSLNISNRNILELCMFEGENLFIWEEEDILNLTDLESSREQEDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56715	0.999	0.999	0.000	2156	1.000	1.000	P56715.pdb.gz	RP1_HUMAN Oxygen-regulated protein 1 OS=Homo sapiens OX=9606 GN=RP1 PE=1 SV=1
2	AFDB:P56716	0.106	0.108	0.000	2095	0.599	0.616	P56716.pdb.gz	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2
3	AFDB:E7F630	0.088	0.081	1.946E-30	2394	0.180	0.162	E7F630.pdb.gz
4	AFDB:Q8CGM2	0.062	0.071	5.094E-24	1859	0.153	0.177	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
5	AFDB:Q8IWN7	0.056	0.052	3.162E-23	2400	0.169	0.152	Q8IWN7.pdb.gz	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
6	PDB:4atuI	0.038	0.666	1.109E-7	106	0.018	0.358	4atuI.pdb.gz	Molecular Basis for Specific Regulation of Neuronal Kinesin- 3 Motors by Doublecortin Family Proteins.
7	AFDB:D3ZUI5	0.046	0.070	1.502E-6	1133	0.074	0.140	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
8	AFDB:Q5NBX1	0.045	0.063	9.873E-6	1337	0.082	0.132	Q5NBX1.pdb.gz	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
9	AFDB:Q53SF7	0.045	0.065	1.958E-5	1128	0.072	0.137	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
10	AFDB:O75128	0.040	0.061	5.789E-5	1261	0.085	0.145	O75128.pdb.gz	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
11	AFDB:E7F568	0.058	0.081	6.870E-5	1343	0.090	0.144	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
12	PDB:7rbsB	0.031	0.332	9.661E-4	157	0.011	0.153	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:6yvaC	0.030	0.334	3.390E-3	155	0.011	0.155	6yvaC.pdb.gz
14	PDB:1j0gA	0.033	0.568	5.243E-2	92	0.006	0.152	1j0gA.pdb.gz
15	PDB:2gowA	0.030	0.397	1.641E-1	116	0.008	0.147	2gowA.pdb.gz
16	PDB:5ia8A	0.034	0.609	3.255E-1	92	0.006	0.152	5ia8A.pdb.gz
17	PDB:3dbhI	0.033	0.608	3.648E-1	86	0.003	0.081	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:3plvA	0.030	0.508	4.089E-1	80	0.007	0.188	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:1wz0A	0.030	0.435	4.584E-1	104	0.005	0.096	1wz0A.pdb.gz
20	PDB:4pyuA	0.032	0.672	4.584E-1	76	0.004	0.105	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56715	0.0	4477	2156	1.000	1.000	RP1_HUMAN Oxygen-regulated protein 1 OS=Homo sapiens OX=9606 GN=RP1 PE=1 SV=1
2	P56716	0.0	2318	2095	0.605	0.623	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2
3	Q8CGM2	6.12e-47	189	1859	0.059	0.068	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
4	Q8IWN7	1.37e-42	175	2400	0.052	0.047	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
5	O43602	7.28e-20	96.3	365	0.032	0.186	DCX_HUMAN Neuronal migration protein doublecortin OS=Homo sapiens OX=9606 GN=DCX PE=1 SV=4
6	O88809	9.30e-20	95.9	366	0.032	0.186	DCX_MOUSE Neuronal migration protein doublecortin OS=Mus musculus OX=10090 GN=Dcx PE=1 SV=1
7	A2A124	9.70e-19	95.5	722	0.034	0.101	A2A124_DANRE Doublecortin like protein kinase_4 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
8	A2A123	1.26e-18	95.1	725	0.034	0.101	A2A123_DANRE Dclk2 protein OS=Danio rerio OX=7955 GN=dclk2 PE=1 SV=1
9	Q9ESI7	1.33e-18	92.4	365	0.031	0.184	DCX_RAT Neuronal migration protein doublecortin OS=Rattus norvegicus OX=10116 GN=Dcx PE=1 SV=2
10	A2A122	3.21e-18	94.0	791	0.034	0.092	A2A122_DANRE Doublecortin like protein kinase_2 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
11	A2A121	4.21e-18	93.6	810	0.034	0.090	A2A121_DANRE Doublecortin like protein kinase_1 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
12	O15075	1.53e-17	91.7	740	0.031	0.091	DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1 PE=1 SV=2
13	G5E9L9	1.63e-17	91.7	695	0.034	0.106	G5E9L9_HUMAN Doublecortin and CaM kinase-like 2, isoform CRA_c OS=Homo sapiens OX=9606 GN=DCLK2 PE=1 SV=1
14	Q9JLM8	2.88e-17	90.9	756	0.031	0.089	DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus OX=10090 GN=Dclk1 PE=1 SV=1
15	D3ZR10	4.88e-17	89.0	475	0.033	0.149	DCDC2_RAT Doublecortin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Dcdc2 PE=1 SV=1
16	Q8N568	5.41e-17	90.1	766	0.034	0.097	DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens OX=9606 GN=DCLK2 PE=1 SV=4
17	Q6PGN3	7.38e-16	86.3	756	0.033	0.094	DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus OX=10090 GN=Dclk2 PE=1 SV=1
18	Q5DU00	1.96e-15	84.0	475	0.033	0.149	DCDC2_MOUSE Doublecortin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcdc2 PE=1 SV=2
19	Q9UHG0	2.66e-15	83.6	476	0.031	0.141	DCDC2_HUMAN Doublecortin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCDC2 PE=1 SV=2
20	Q95QC4	3.80e-15	84.0	802	0.031	0.084	DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans OX=6239 GN=zyg-8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03607 DCX	9e-31	117.0	Doublecortin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220676

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367766	0.941	X-linked retinitis pigmentosa GTPase regulator
2	9606.ENSP00000264276	0.708	Alsin
3	9606.ENSP00000238616	0.700	Serine/threonine-protein kinase Nek9
4	9606.ENSP00000261609	0.697	E3 ubiquitin-protein ligase HERC2
5	9606.ENSP00000265965	0.697	Secretion-regulating guanine nucleotide exchange factor
6	9606.ENSP00000362937	0.697	Regulator of chromosome condensation
7	9606.ENSP00000367552	0.697	RCC1 and BTB domain-containing protein 1
8	9606.ENSP00000371051	0.697	Zinc finger ZZ-type and EF-hand domain containing 1
9	9606.ENSP00000377801	0.697	RCC1 domain-containing protein 1
10	9606.ENSP00000389910	0.697	RCC1 and BTB domain containing protein 2
11	9606.ENSP00000390158	0.697	Probable E3 ubiquitin-protein ligase HERC1
12	9606.ENSP00000449784	0.697	Probable E3 ubiquitin-protein ligase HECTD4
13	9606.ENSP00000480364	0.697	RCC1-like G exchanging factor-like protein
14	9606.ENSP00000375855	0.570	Phosducin
15	9606.ENSP00000314499	0.549	Cyclin-G-associated kinase
16	9606.ENSP00000371923	0.540	Retinitis pigmentosa 1-like 1 protein
17	9606.ENSP00000305721	0.531	Inhibitor of Bruton tyrosine kinase
18	9606.ENSP00000317955	0.531	Early endosome antigen 1
19	9606.ENSP00000364585	0.531	Protein RCC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0032501	0.983	multicellular organismal process
GO:0051716	0.935	cellular response to stimulus
GO:0050953	0.917	sensory perception of light stimulus
GO:0007165	0.917	signal transduction
GO:0009583	0.810	detection of light stimulus
GO:0009584	0.802	detection of visible light
GO:0007602	0.780	phototransduction
GO:0007601	0.773	visual perception
GO:0071840	0.545	cellular component organization or biogenesis
GO:0016043	0.500	cellular component organization
GO:0048519	0.413	negative regulation of biological process
GO:0048518	0.405	positive regulation of biological process
GO:0048522	0.389	positive regulation of cellular process
GO:0006996	0.361	organelle organization
GO:0007603	0.305	phototransduction, visible light

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001917	1.000	photoreceptor inner segment
GO:0032391	1.000	photoreceptor connecting cilium
GO:0005622	0.971	intracellular anatomical structure
GO:0005737	0.963	cytoplasm
GO:0043229	0.963	intracellular organelle
GO:0043232	0.890	intracellular non-membrane-bounded organelle
GO:0043231	0.823	intracellular membrane-bounded organelle
GO:0005829	0.810	cytosol
GO:0032991	0.716	protein-containing complex
GO:0005856	0.704	cytoskeleton
GO:0015630	0.622	microtubule cytoskeleton
GO:0016020	0.553	membrane
GO:0005634	0.542	nucleus
GO:0070013	0.371	intracellular organelle lumen
GO:0031981	0.352	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]