StarFunc result for job id P56915

User Input

>input (257 residues)
MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPR
PVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGY
EGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQ
ETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKA
SPEKREEEGKSDLDSDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56915	1.000	1.000	2.894E-39	257	1.000	1.000	P56915.pdb.gz	GSC_HUMAN Homeobox protein goosecoid OS=Homo sapiens OX=9606 GN=GSC PE=1 SV=2
2	AFDB:Q9UBX0	0.295	0.395	9.796E-9	185	0.214	0.297	Q9UBX0.pdb.gz	HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens OX=9606 GN=HESX1 PE=1 SV=1
3	AFDB:Q04744	0.274	0.277	1.363E-7	253	0.245	0.249	Q04744.pdb.gz	EMX2_MOUSE Homeobox protein EMX2 OS=Mus musculus OX=10090 GN=Emx2 PE=1 SV=3
4	AFDB:B8JMG4	0.227	0.209	1.773E-7	280	0.253	0.232	B8JMG4.pdb.gz
5	AFDB:Q15699	0.271	0.217	2.023E-7	326	0.265	0.209	Q15699.pdb.gz	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
6	AFDB:Q61658	0.287	0.377	2.023E-7	185	0.206	0.286	Q61658.pdb.gz	HESX1_MOUSE Homeobox expressed in ES cells 1 OS=Mus musculus OX=10090 GN=Hesx1 PE=2 SV=2
7	AFDB:P58304	0.244	0.176	2.811E-7	361	0.280	0.199	P58304.pdb.gz	VSX2_HUMAN Visual system homeobox 2 OS=Homo sapiens OX=9606 GN=VSX2 PE=1 SV=1
8	AFDB:B2GRU4	0.264	0.347	4.760E-7	192	0.241	0.323	B2GRU4.pdb.gz
9	AFDB:O42356	0.241	0.191	5.084E-7	330	0.261	0.203	O42356.pdb.gz	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
10	AFDB:O18381	0.230	0.076	8.059E-7	857	0.249	0.075	O18381.pdb.gz	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
11	PDB:2hi3A	0.191	0.609	1.055E-2	73	0.086	0.301	2hi3A.pdb.gz
12	PDB:4egcA	0.182	0.087	3.934E-2	539	0.058	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.144	0.228	2.178E-1	153	0.051	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:7dcoL	0.145	0.090	7.122E-1	435	0.070	0.041	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:6c0f7	0.161	0.227	8.676E-1	156	0.086	0.141	6c0f7.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
16	PDB:4zzlA	0.116	0.185	1.057	146	0.047	0.082	4zzlA.pdb.gz
17	PDB:7b93E	0.115	0.134	1.375	215	0.031	0.037	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
18	PDB:4ldzA	0.109	0.139	1.911	196	0.043	0.056	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
19	PDB:5fywR	0.142	0.180	2.042	199	0.054	0.070	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
20	PDB:4lgwA	0.109	0.117	2.180	238	0.039	0.042	4lgwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56915	0.0	532	257	1.000	1.000	GSC_HUMAN Homeobox protein goosecoid OS=Homo sapiens OX=9606 GN=GSC PE=1 SV=2
2	Q02591	0.0	511	256	0.969	0.973	GSC_MOUSE Homeobox protein goosecoid OS=Mus musculus OX=10090 GN=Gsc PE=1 SV=1
3	P53544	6.19e-119	341	240	0.735	0.787	GSC_DANRE Homeobox protein goosecoid OS=Danio rerio OX=7955 GN=gsc PE=2 SV=1
4	P56916	3.44e-28	108	201	0.191	0.244	GSC2_MOUSE Homeobox protein goosecoid-2 OS=Mus musculus OX=10090 GN=Gsc2 PE=2 SV=2
5	O15499	4.53e-27	105	205	0.183	0.229	GSC2_HUMAN Homeobox protein goosecoid-2 OS=Homo sapiens OX=9606 GN=GSC2 PE=1 SV=1
6	P54366	4.97e-26	107	415	0.191	0.118	GSC_DROME Homeobox protein goosecoid OS=Drosophila melanogaster OX=7227 GN=Gsc PE=2 SV=2
7	A6NNA5	2.06e-22	94.7	263	0.160	0.156	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
8	Q8BYH0	2.50e-22	94.7	263	0.160	0.156	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
9	Q1LVQ7	6.33e-21	92.0	320	0.152	0.122	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
10	Q5I7G4	7.02e-21	91.3	284	0.226	0.204	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1
11	Q6NYV4	9.07e-21	90.9	277	0.171	0.159	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
12	F1RCT9	9.62e-21	90.9	280	0.202	0.186	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
13	Q9NZR4	2.00e-20	91.3	365	0.167	0.118	VSX1_HUMAN Visual system homeobox 1 OS=Homo sapiens OX=9606 GN=VSX1 PE=1 SV=2
14	A0A0G2JYE6	4.42e-20	89.4	314	0.187	0.153	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
15	O35690	4.42e-20	89.4	314	0.187	0.153	PHX2B_MOUSE Paired mesoderm homeobox protein 2B OS=Mus musculus OX=10090 GN=Phox2b PE=1 SV=1
16	Q99453	4.42e-20	89.4	314	0.187	0.153	PHX2B_HUMAN Paired mesoderm homeobox protein 2B OS=Homo sapiens OX=9606 GN=PHOX2B PE=1 SV=2
17	Q8C8B0	5.18e-20	89.4	326	0.152	0.120	ALX1_MOUSE ALX homeobox protein 1 OS=Mus musculus OX=10090 GN=Alx1 PE=1 SV=1
18	Q15699	5.45e-20	89.4	326	0.152	0.120	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
19	V9HWA7	5.45e-20	89.4	326	0.152	0.120	V9HWA7_HUMAN Cartilage paired-class homeoprotein 1 OS=Homo sapiens OX=9606 GN=HEL23 PE=2 SV=1
20	Q63087	5.61e-20	89.4	326	0.152	0.120	ALX1_RAT ALX homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Alx1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	8.9	17.6	Homeobox KN domain
2	PF00046 Homeodomain	2.6e-19	80.1	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238558

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262904	0.902	Transcription factor E2F3
2	9606.ENSP00000345571	0.902	Transcription factor E2F1
3	9606.ENSP00000355249	0.902	Transcription factor E2F2
4	9606.ENSP00000227163	0.900	Transcription factor PU.1
5	9606.ENSP00000267163	0.900	Retinoblastoma-associated protein
6	9606.ENSP00000364519	0.900	Transcription factor Dp-1
7	9606.ENSP00000296946	0.701	Brachyury protein
8	9606.ENSP00000426653	0.667	Protein Wnt-8a
9	9606.ENSP00000204604	0.647	Chordin
10	9606.ENSP00000297316	0.596	Transcription factor SOX-17
11	9606.ENSP00000245451	0.592	Bone morphogenetic protein 4
12	9606.ENSP00000366534	0.591	Forkhead box protein H1
13	9606.ENSP00000400341	0.591	Hepatocyte nuclear factor 3-beta
14	9606.ENSP00000262160	0.554	Mothers against decapentaplegic homolog 2
15	9606.ENSP00000011292	0.542	Carboxypeptidase A1
16	9606.ENSP00000296145	0.541	Teratocarcinoma-derived growth factor 1
17	9606.ENSP00000344456	0.534	Catenin beta-1
18	9606.ENSP00000287139	0.531	Nodal homolog
19	9606.ENSP00000370256	0.531	Forkhead box protein C1
20	9606.ENSP00000326371	0.520	Forkhead box protein C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.978	protein binding
GO:0003700	0.971	DNA-binding transcription factor activity
GO:0000976	0.935	transcription cis-regulatory region binding
GO:0000981	0.931	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.837	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.545	DNA-binding transcription activator activity
GO:0001228	0.446	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.440	cis-regulatory region sequence-specific DNA binding
GO:0008134	0.433	transcription factor binding
GO:0140297	0.392	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.998	anatomical structure development
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0032501	0.990	multicellular organismal process
GO:0007275	0.975	multicellular organism development
GO:0048731	0.965	system development
GO:0048513	0.947	animal organ development
GO:0019222	0.946	regulation of metabolic process
GO:0060255	0.917	regulation of macromolecule metabolic process
GO:0010468	0.912	regulation of gene expression
GO:0009888	0.893	tissue development
GO:0050896	0.885	response to stimulus
GO:0009653	0.881	anatomical structure morphogenesis
GO:0006355	0.877	regulation of DNA-templated transcription
GO:0048519	0.872	negative regulation of biological process
GO:0006357	0.861	regulation of transcription by RNA polymerase II
GO:0048518	0.841	positive regulation of biological process
GO:0048522	0.831	positive regulation of cellular process
GO:0009790	0.780	embryo development
GO:0048523	0.765	negative regulation of cellular process
GO:0048598	0.731	embryonic morphogenesis
GO:0009893	0.707	positive regulation of metabolic process
GO:0010604	0.696	positive regulation of macromolecule metabolic process
GO:0051173	0.689	positive regulation of nitrogen compound metabolic process
GO:0031325	0.689	positive regulation of cellular metabolic process
GO:0030154	0.688	cell differentiation
GO:0048583	0.682	regulation of response to stimulus
GO:0010646	0.668	regulation of cell communication
GO:0051716	0.605	cellular response to stimulus
GO:0023051	0.590	regulation of signaling
GO:0048568	0.589	embryonic organ development
GO:0007154	0.564	cell communication
GO:0023052	0.551	signaling
GO:0009966	0.551	regulation of signal transduction
GO:0045893	0.537	positive regulation of DNA-templated transcription
GO:0045944	0.504	positive regulation of transcription by RNA polymerase II
GO:0007165	0.494	signal transduction
GO:0007399	0.458	nervous system development
GO:0009892	0.451	negative regulation of metabolic process
GO:0010605	0.441	negative regulation of macromolecule metabolic process
GO:0043009	0.420	chordate embryonic development
GO:0007166	0.406	cell surface receptor signaling pathway
GO:0009887	0.402	animal organ morphogenesis
GO:0050793	0.345	regulation of developmental process
GO:0051172	0.326	negative regulation of nitrogen compound metabolic process
GO:0031324	0.326	negative regulation of cellular metabolic process
GO:1903507	0.323	negative regulation of nucleic acid-templated transcription
GO:0045892	0.308	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.974	protein-containing complex
GO:0005667	0.874	transcription regulator complex
GO:0005737	0.312	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]