StarFunc result for job id P56945

User Input

>input (870 residues)
MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTP
SKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
SAAQDMVERVKELGHSTQQFRRVLGQLAAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63767	0.344	0.313	1.101E-91	968	0.911	0.819	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
2	AFDB:A0A024QZV9	0.240	0.250	1.995E-45	834	0.405	0.422	A0A024QZV9.pdb.gz
3	AFDB:O35177	0.247	0.258	5.924E-45	833	0.400	0.418	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
4	AFDB:F1NW90	0.265	0.278	2.015E-44	823	0.392	0.414	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
5	AFDB:A4IJ58	0.173	0.181	2.878E-31	831	0.264	0.277	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
6	AFDB:Q9NQ75	0.218	0.236	7.762E-27	786	0.232	0.257	Q9NQ75.pdb.gz	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
7	AFDB:O43281	0.161	0.240	2.200E-17	561	0.225	0.349	O43281.pdb.gz	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
8	AFDB:Q64355	0.191	0.279	1.178E-16	560	0.244	0.379	Q64355.pdb.gz	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
9	AFDB:M0R4F8	0.112	0.074	1.852E-7	1577	0.159	0.088	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
10	AFDB:Q54DW4	0.085	0.065	2.569E-6	1350	0.162	0.104	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
11	PDB:1k9aB	0.063	0.123	1.540E-3	441	0.017	0.034	1k9aB.pdb.gz
12	PDB:2dybA	0.067	0.190	2.906E-3	298	0.022	0.064	2dybA.pdb.gz
13	PDB:1griA	0.062	0.251	3.182E-3	211	0.020	0.081	1griA.pdb.gz
14	PDB:3ehqA	0.062	0.282	3.484E-3	182	0.020	0.093	3ehqA.pdb.gz
15	PDB:3qwyA	0.066	0.321	3.484E-3	170	0.016	0.082	3qwyA.pdb.gz
16	PDB:1k0xA	0.062	0.457	1.358E-2	108	0.021	0.167	1k0xA.pdb.gz
17	PDB:2lqnA	0.068	0.185	1.358E-2	303	0.022	0.063	2lqnA.pdb.gz
18	PDB:2h8hA	0.058	0.112	2.681E-2	445	0.021	0.040	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:6fuyA	0.131	0.119	2.805E-2	961	0.079	0.072	6fuyA.pdb.gz
20	PDB:2eyzA	0.068	0.185	4.032E-2	304	0.020	0.056	2eyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56945	0.0	1748	870	1.000	1.000	BCAR1_HUMAN Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2
2	Q61140	0.0	1491	874	0.908	0.904	BCAR1_MOUSE Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus OX=10090 GN=Bcar1 PE=1 SV=2
3	Q63767	0.0	1504	968	0.913	0.820	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
4	Q6P5Z4	0.0	1744	870	0.998	0.998	Q6P5Z4_HUMAN Breast cancer anti-estrogen resistance 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=2 SV=1
5	F1NW90	6.35e-172	520	823	0.418	0.442	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
6	O35177	9.49e-172	520	833	0.422	0.441	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
7	Q14511	6.67e-169	513	834	0.433	0.452	CASL_HUMAN Enhancer of filamentation 1 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1
8	A0A8I3PDQ1	2.03e-166	506	834	0.428	0.446	CASL_CANLF Enhancer of filamentation 1 OS=Canis lupus familiaris OX=9615 GN=NEDD9 PE=1 SV=1
9	A0A087WUD2	7.23e-126	396	685	0.337	0.428	A0A087WUD2_HUMAN Neural precursor cell expressed, developmentally down-regulated 9 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1
10	Q9YHC0	7.77e-48	174	316	0.172	0.475	Q9YHC0_CHICK Enhancer of filamentation 1 homolog (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q95U71	2.09e-47	180	568	0.163	0.250	Q95U71_DROME GH02705p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=2 SV=1
12	B7Z0H1	2.10e-47	180	567	0.163	0.250	B7Z0H1_DROME P130CAS, isoform E OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=4 SV=1
13	Q7KVE5	2.08e-46	181	793	0.164	0.180	Q7KVE5_DROME Crk-associated substrate OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=2 SV=1
14	A4IJ58	2.97e-46	180	831	0.164	0.172	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
15	O43281	6.82e-30	127	561	0.095	0.148	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
16	Q64355	1.66e-22	105	560	0.077	0.120	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
17	Q9NQ75	1.78e-17	89.7	786	0.077	0.085	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
18	P34109	1.34e-08	61.2	1109	0.041	0.032	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
19	H0YKF1	1.58e-08	56.2	133	0.029	0.188	H0YKF1_HUMAN Proline-serine-threonine phosphatase interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1
20	Q5I1X5	7.09e-08	58.9	824	0.031	0.033	IASPP_MOUSE RelA-associated inhibitor OS=Mus musculus OX=10090 GN=Ppp1r13l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12026 CAS_C	1.5e-73	258.7	Crk-Associated Substrate C-terminal domain
2	PF08824 Serine_rich	6.7e-40	148.2	Serine rich protein interaction domain
3	PF00018 SH3_1	4.2e-10	50.4	SH3 domain
4	PF07653 SH3_2	5.6e-07	40.6	Variant SH3 domain
5	PF14604 SH3_9	1.4e-09	49.1	Variant SH3 domain
6	PF01044 Vinculin	26	14.5	Vinculin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267257	0.999	Paxillin
2	9606.ENSP00000280333	0.999	Dedicator of cytokinesis protein 1
3	9606.ENSP00000300574	0.999	Adapter molecule crk
4	9606.ENSP00000341189	0.999	Focal adhesion kinase 1
5	9606.ENSP00000346300	0.999	Crk-like protein
6	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000380638	0.999	Protein-tyrosine kinase 2-beta
8	9606.ENSP00000211998	0.998	Vinculin
9	9606.ENSP00000324422	0.997	Zyxin
10	9606.ENSP00000346671	0.995	Tyrosine-protein kinase Fyn
11	9606.ENSP00000359264	0.995	Breast cancer anti-estrogen resistance protein 3
12	9606.ENSP00000405330	0.995	Estrogen receptor
13	9606.ENSP00000248594	0.994	Tyrosine-protein phosphatase non-receptor type 12
14	9606.ENSP00000360683	0.994	Tyrosine-protein phosphatase non-receptor type 1
15	9606.ENSP00000361263	0.993	Rap guanine nucleotide exchange factor 1
16	9606.ENSP00000417273	0.993	Cytoplasmic protein NCK1
17	9606.ENSP00000376345	0.991	Growth factor receptor-bound protein 2
18	9606.ENSP00000200457	0.987	Thyroid receptor-interacting protein 6
19	9606.ENSP00000428924	0.983	Tyrosine-protein kinase Lyn
20	9606.ENSP00000171887	0.981	Tensin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.772	enzyme binding
GO:0019904	0.482	protein domain specific binding
GO:0019900	0.355	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0007167	0.985	enzyme-linked receptor protein signaling pathway
GO:0048870	0.980	cell motility
GO:0048518	0.976	positive regulation of biological process
GO:0016477	0.970	cell migration
GO:0048522	0.912	positive regulation of cellular process
GO:0016043	0.887	cellular component organization
GO:0007169	0.885	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009719	0.841	response to endogenous stimulus
GO:0007186	0.822	G protein-coupled receptor signaling pathway
GO:0048583	0.779	regulation of response to stimulus
GO:0042221	0.679	response to chemical
GO:0048519	0.612	negative regulation of biological process
GO:0071495	0.601	cellular response to endogenous stimulus
GO:0048523	0.597	negative regulation of cellular process
GO:0070887	0.579	cellular response to chemical stimulus
GO:0048584	0.520	positive regulation of response to stimulus
GO:0030155	0.471	regulation of cell adhesion
GO:0030335	0.446	positive regulation of cell migration
GO:0030029	0.369	actin filament-based process
GO:0019222	0.367	regulation of metabolic process
GO:0006996	0.355	organelle organization
GO:0032501	0.328	multicellular organismal process
GO:0002682	0.326	regulation of immune system process
GO:0071310	0.321	cellular response to organic substance
GO:0051128	0.319	regulation of cellular component organization
GO:0051239	0.310	regulation of multicellular organismal process
GO:0070848	0.305	response to growth factor
GO:0007010	0.301	cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005925	0.999	focal adhesion
GO:0042995	0.979	cell projection
GO:0043226	0.978	organelle
GO:0120025	0.974	plasma membrane bounded cell projection
GO:0043229	0.969	intracellular organelle
GO:0031252	0.964	cell leading edge
GO:0043232	0.925	intracellular non-membrane-bounded organelle
GO:0043227	0.797	membrane-bounded organelle
GO:0043231	0.758	intracellular membrane-bounded organelle
GO:0005856	0.556	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]