StarFunc result for job id P56975

User Input

>input (720 residues)
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPATVPSTTAPFFSSSTLGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQ
VLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPG
QRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPI
QLWCVERPLDLKYSSSGLKTQRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPI
IPSVGLEETCLQMPGISEVKSIKWCKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQE
QIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56975	0.999	0.999	3.273E-98	720	1.000	1.000	P56975.pdb.gz	NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG3 PE=1 SV=1
2	AFDB:Q6DR99	0.156	0.159	5.878E-15	700	0.210	0.216	Q6DR99.pdb.gz	Q6DR99_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
3	AFDB:A0A0B4KF25	0.048	0.036	1.448E-2	1131	0.122	0.078	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
4	AFDB:A4FU49	0.070	0.077	3.918E-2	640	0.149	0.167	A4FU49.pdb.gz	SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens OX=9606 GN=SH3D21 PE=2 SV=2
5	AFDB:Q6P9L3	0.058	0.042	1.803E-1	1114	0.151	0.098	Q6P9L3.pdb.gz	Q6P9L3_MOUSE Bptf protein OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
6	AFDB:Q9Y4B4	0.041	0.024	1.803E-1	1467	0.089	0.044	Q9Y4B4.pdb.gz	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
7	AFDB:B8JIA4	0.052	0.033	2.684E-1	1461	0.103	0.051	B8JIA4.pdb.gz	B8JIA4_DANRE Histone-lysine N-methyltransferase NSD2 OS=Danio rerio OX=7955 GN=fc12c04 PE=1 SV=1
8	PDB:7nycC	0.043	0.038	2.703E-1	809	0.019	0.017	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
9	AFDB:Q10124	0.091	0.043	4.271E-1	1647	0.119	0.052	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
10	PDB:6h03C	0.043	0.059	4.596E-1	513	0.017	0.023	6h03C.pdb.gz
11	AFDB:Q6AWN7	0.056	0.041	5.569E-1	1049	0.113	0.077	Q6AWN7.pdb.gz	Q6AWN7_DROME RE48574p OS=Drosophila melanogaster OX=7227 GN=ko PE=2 SV=1
12	AFDB:Q8IGP7	0.078	0.072	5.951E-1	781	0.119	0.110	Q8IGP7.pdb.gz	Q8IGP7_DROME RE52507p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Incenp PE=2 SV=1
13	PDB:3t5oA	0.047	0.039	6.843E-1	871	0.019	0.016	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
14	PDB:4wqsN	0.040	0.023	8.351E-1	1288	0.008	0.005	4wqsN.pdb.gz	The Ratcheted and Ratchetable Structural States of RNA Polymerase Underlie Multiple Transcriptional Functions.
15	PDB:7nycD	0.042	0.061	8.924E-1	487	0.015	0.023	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:6edtJ	0.035	0.171	1.243	109	0.022	0.147	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
17	PDB:1gg4A	0.035	0.055	1.852	439	0.010	0.016	1gg4A.pdb.gz
18	PDB:7q3nU	0.040	0.088	1.979	292	0.014	0.034	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
19	PDB:3eqlD	0.036	0.020	2.414	1321	0.006	0.003	3eqlD.pdb.gz	Transcription inactivation through local refolding of the RNA polymerase structure.
20	PDB:1e8cB	0.026	0.037	2.757	497	0.003	0.004	1e8cB.pdb.gz	Crystal Structure of Udp-N-Acetylmuramoyl-L-Alanyl-D-Glutamate: Meso-Diaminopimelate Ligase from Escherichia Coli

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35181	0.0	1207	713	0.857	0.865	NRG3_MOUSE Pro-neuregulin-3, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg3 PE=1 SV=1
2	P56975	0.0	1482	720	1.000	1.000	NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG3 PE=1 SV=1
3	Q6DR99	7.55e-30	128	700	0.158	0.163	Q6DR99_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
4	A0A1B4Z255	1.11e-24	111	604	0.110	0.131	A0A1B4Z255_DANRE Neuregulin1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
5	A0A0R4IBM0	1.85e-24	111	730	0.110	0.108	A0A0R4IBM0_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
6	A0A494C1F8	7.02e-22	102	607	0.057	0.068	A0A494C1F8_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
7	Q6DR98	1.57e-21	102	645	0.069	0.078	NRG1_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
8	P56974	2.74e-19	95.1	756	0.062	0.060	NRG2_MOUSE Pro-neuregulin-2, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg2 PE=1 SV=1
9	A0A0R4IFE6	4.39e-19	94.4	687	0.106	0.111	A0A0R4IFE6_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
10	B3DK99	7.01e-19	93.2	599	0.103	0.124	B3DK99_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
11	A0A0R4IDP7	9.55e-19	93.2	725	0.103	0.102	A0A0R4IDP7_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
12	O35569	1.19e-18	93.2	868	0.061	0.051	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
13	A0A0R4IPH3	1.90e-18	92.4	722	0.100	0.100	A0A0R4IPH3_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
14	Q02297	7.68e-17	87.0	640	0.050	0.056	NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=3
15	P43322	2.72e-16	85.5	662	0.065	0.071	NRG1_RAT Pro-neuregulin-1, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg1 PE=1 SV=1
16	A5D6U9	9.96e-15	79.7	488	0.053	0.078	A5D6U9_DANRE Neuregulin 2a OS=Danio rerio OX=7955 GN=nrg2a PE=2 SV=1
17	O14511	2.90e-14	79.0	850	0.054	0.046	NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG2 PE=1 SV=1
18	Q9WTX4	1.25e-05	47.0	115	0.031	0.191	NRG4_MOUSE Pro-neuregulin-4, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg4 PE=1 SV=1
19	Q8WWG1	4.71e-05	45.4	115	0.031	0.191	NRG4_HUMAN Pro-neuregulin-4, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG4 PE=1 SV=1
20	Q6PK61	2.11e-04	45.8	241	0.021	0.062	Q6PK61_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20087 DUF6479	1.1e+02	14.8	Family of unknown function (DUF6479)
2	PF20316 DUF6612	1.4e+02	13.5	Family of unknown function (DUF6612)
3	PF00008 EGF	7.3	18.3	EGF-like domain
4	PF00053 Laminin_EGF	1.8e+02	13.7	Laminin EGF domain
5	PF06305 LapA_dom	4.1e+02	12.2	Lipopolysaccharide assembly protein A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008951807.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003812552.1	0.983	Erb-b2 receptor tyrosine kinase 4
2	9597.XP_003819017.1	0.972	Neuregulin 4
3	9597.XP_003829393.2	0.953	Pro-neuregulin-2, membrane-bound isoform
4	9597.XP_008954422.1	0.944	Pro-neuregulin-1, membrane-bound isoform isoform X1
5	9597.XP_008976919.1	0.862	Receptor tyrosine-protein kinase erbB-3
6	9597.XP_008967087.1	0.817	Epidermal growth factor receptor
7	9597.XP_008955053.1	0.754	Erb-b2 receptor tyrosine kinase 2
8	9597.XP_008958930.1	0.749	Calcium-dependent secretion activator 2 isoform X1
9	9597.XP_008971618.1	0.692	Autism susceptibility gene 2 protein isoform X1
10	9597.XP_003826871.1	0.677	Potassium voltage-gated channel interacting protein 4
11	9597.XP_003806041.1	0.664	HRas proto-oncogene, GTPase
12	9597.XP_008971793.1	0.659	Neuroblastoma RAS viral oncogene homolog
13	9597.XP_008951027.1	0.658	Erbb2 interacting protein
14	9597.XP_008955970.1	0.658	Probetacellulin
15	9597.XP_008958128.1	0.658	Mitogen-activated protein kinase 1
16	9597.XP_008959823.1	0.658	Mitogen-activated protein kinase 3
17	9597.XP_003826994.1	0.632	Disintegrin and metalloproteinase domain-containing protein 17 isoform X1
18	9597.XP_003812415.2	0.631	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
19	9597.XP_008964521.1	0.631	Protein kinase C beta type isoform X1
20	9597.XP_003805316.1	0.628	Tyrosine-protein phosphatase non-receptor type 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050896	0.998	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.992	signaling
GO:0007154	0.992	cell communication
GO:0051716	0.985	cellular response to stimulus
GO:0007166	0.975	cell surface receptor signaling pathway
GO:0038127	0.972	ERBB signaling pathway
GO:0010646	0.894	regulation of cell communication
GO:0023051	0.882	regulation of signaling
GO:0032502	0.525	developmental process
GO:0048856	0.522	anatomical structure development
GO:0032501	0.507	multicellular organismal process
GO:0048518	0.469	positive regulation of biological process
GO:0007275	0.461	multicellular organism development
GO:0048731	0.428	system development
GO:0048522	0.387	positive regulation of cellular process
GO:0048519	0.348	negative regulation of biological process
GO:0048583	0.307	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0098978	0.998	glutamatergic synapse
GO:0071944	0.957	cell periphery
GO:0005886	0.949	plasma membrane
GO:0043226	0.942	organelle
GO:0005622	0.813	intracellular anatomical structure
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0005737	0.583	cytoplasm
GO:0043233	0.479	organelle lumen
GO:0070013	0.471	intracellular organelle lumen
GO:0012505	0.340	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]