StarFunc result for job id P57053

User Input

>input (126 residues)
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:U3KQK0	0.708	0.543	1.244E-17	166	0.960	0.729	U3KQK0.pdb.gz	U3KQK0_HUMAN Histone H2B OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=1
2	PDB:2rvqD	0.892	0.873	1.903E-17	129	0.976	0.953	2rvqD.pdb.gz
3	AFDB:P70696	0.803	0.798	1.404E-16	127	0.873	0.866	P70696.pdb.gz	H2B1A_MOUSE Histone H2B type 1-A OS=Mus musculus OX=10090 GN=H2bc1 PE=1 SV=3
4	AFDB:P04255	0.758	0.783	4.124E-15	122	0.738	0.762	P04255.pdb.gz	H2B1_CAEEL Histone H2B 1 OS=Caenorhabditis elegans OX=6239 GN=his-11 PE=1 SV=4
5	AFDB:P02283	0.754	0.773	1.007E-14	123	0.770	0.789	P02283.pdb.gz	H2B_DROME Histone H2B OS=Drosophila melanogaster OX=7227 GN=His2B PE=1 SV=2
6	AFDB:Q59VP1	0.694	0.673	3.383E-14	130	0.683	0.662	Q59VP1.pdb.gz	H2B2_CANAL Histone H2B.2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HTB2 PE=3 SV=3
7	AFDB:P23754	0.696	0.630	4.097E-14	140	0.675	0.607	P23754.pdb.gz	H2B_EMENI Histone H2B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=htbA PE=3 SV=2
8	AFDB:P04913	0.697	0.697	8.262E-14	126	0.659	0.659	P04913.pdb.gz	H2B1_SCHPO Histone H2B-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=htb1 PE=1 SV=3
9	AFDB:Q6CK60	0.693	0.663	1.000E-13	132	0.651	0.621	Q6CK60.pdb.gz	H2B1_KLULA Histone H2B.1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=HTB1 PE=1 SV=3
10	AFDB:Q9SF55	0.672	0.672	1.211E-13	126	0.643	0.643	Q9SF55.pdb.gz	H2B5_ARATH Histone H2B.5 OS=Arabidopsis thaliana OX=3702 GN=At3g09480 PE=1 SV=3
11	AFDB:Q9FFC0	0.679	0.593	1.291E-13	145	0.667	0.579	Q9FFC0.pdb.gz	H2B10_ARATH Histone H2B.10 OS=Arabidopsis thaliana OX=3702 GN=At5g22880 PE=1 SV=3
12	PDB:7pj1B	0.645	0.664	2.105E-13	122	0.754	0.779	7pj1B.pdb.gz
13	PDB:6gejG	0.671	0.863	1.510E-11	96	0.579	0.760	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:6a7uA	0.648	0.488	2.185E-9	170	0.683	0.506	6a7uA.pdb.gz
15	PDB:1jfiB	0.494	0.465	1.526E-3	135	0.127	0.119	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
16	PDB:5y27A	0.533	0.660	2.708E-3	98	0.095	0.122	5y27A.pdb.gz
17	PDB:5ay8A	0.484	0.622	5.125E-3	97	0.111	0.144	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
18	PDB:2rvqC	0.421	0.403	8.536E-3	133	0.167	0.158	2rvqC.pdb.gz
19	PDB:7xayD	0.490	0.628	9.698E-3	97	0.151	0.196	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
20	PDB:1kx5B	0.460	0.553	1.034E-2	102	0.143	0.176	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57053	1.42e-88	254	126	1.000	1.000	H2BFS_HUMAN Histone H2B type F-S OS=Homo sapiens OX=9606 GN=H2BC12L PE=1 SV=2
2	O60814	5.99e-87	250	126	0.984	0.984	H2B1K_HUMAN Histone H2B type 1-K OS=Homo sapiens OX=9606 GN=H2BC12 PE=1 SV=3
3	P06899	1.04e-86	249	126	0.976	0.976	H2B1J_HUMAN Histone H2B type 1-J OS=Homo sapiens OX=9606 GN=H2BC11 PE=1 SV=3
4	B2R4S9	1.57e-86	249	126	0.976	0.976	B2R4S9_HUMAN Histone H2B OS=Homo sapiens OX=9606 GN=HIST1H2BE PE=2 SV=1
5	P62807	1.57e-86	249	126	0.976	0.976	H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4
6	Q6ZWY9	1.57e-86	249	126	0.976	0.976	H2B1C_MOUSE Histone H2B type 1-C/E/G OS=Mus musculus OX=10090 GN=H2bc4 PE=1 SV=3
7	Q16778	2.72e-86	248	126	0.968	0.968	H2B2E_HUMAN Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3
8	Q64478	4.23e-86	248	126	0.968	0.968	H2B1H_MOUSE Histone H2B type 1-H OS=Mus musculus OX=10090 GN=H2bc9 PE=1 SV=3
9	Q99877	4.37e-86	248	126	0.968	0.968	H2B1N_HUMAN Histone H2B type 1-N OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=3
10	Q8CGP1	5.32e-86	248	126	0.976	0.976	H2B1K_MOUSE Histone H2B type 1-K OS=Mus musculus OX=10090 GN=H2bc12 PE=1 SV=3
11	Q93079	5.56e-86	248	126	0.968	0.968	H2B1H_HUMAN Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3
12	P10854	6.70e-86	248	126	0.968	0.968	H2B1M_MOUSE Histone H2B type 1-M OS=Mus musculus OX=10090 GN=H2bc14 PE=1 SV=2
13	P58876	6.70e-86	248	126	0.968	0.968	H2B1D_HUMAN Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2
14	P23527	9.95e-86	247	126	0.960	0.960	H2B1O_HUMAN Histone H2B type 1-O OS=Homo sapiens OX=9606 GN=H2BC17 PE=1 SV=3
15	P33778	1.25e-85	247	126	0.952	0.952	H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2
16	P10853	1.44e-85	247	126	0.968	0.968	H2B1F_MOUSE Histone H2B type 1-F/J/L OS=Mus musculus OX=10090 GN=H2bc7 PE=1 SV=2
17	U3KQK0	2.13e-85	248	166	0.968	0.735	U3KQK0_HUMAN Histone H2B OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=1
18	Q5QNW6	2.47e-85	246	126	0.960	0.960	H2B2F_HUMAN Histone H2B type 2-F OS=Homo sapiens OX=9606 GN=H2BC18 PE=1 SV=3
19	Q64525	2.47e-85	246	126	0.960	0.960	H2B2B_MOUSE Histone H2B type 2-B OS=Mus musculus OX=10090 GN=Hist2h2bb PE=1 SV=3
20	Q0D2M2	2.88e-85	246	126	0.968	0.968	Q0D2M2_HUMAN HIST1H2BC protein OS=Homo sapiens OX=9606 GN=HIST1H2BC PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.024	26.2	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF19759 DUF6246	2.5e+02	12.9	Family of unknown function (DUF6246)
3	PF00125 Histone	4.4e-21	86.9	Core histone H2A/H2B/H3/H4
4	PF03847 TFIID_20kDa	2.1e+02	13.8	Transcription initiation factor TFIID subunit A
5	PF16789 YscO-like	16	16.9	YscO-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481622

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367022	0.947	Histone H2A type 1-C
2	9606.ENSP00000438553	0.945	Histone H2A.J
3	9606.ENSP00000351589	0.943	Histone cluster 1 H2A family member i
4	9606.ENSP00000332790	0.940	Histone H2A type 2-B
5	9606.ENSP00000332194	0.935	Histone H2A type 2-C
6	9606.ENSP00000355656	0.934	Histone H2A type 3
7	9606.ENSP00000308405	0.930	Histone H2A.V
8	9606.ENSP00000272317	0.926	Ubiquitin-40S ribosomal protein S27a
9	9606.ENSP00000296417	0.925	Histone H2A.Z
10	9606.ENSP00000225916	0.921	Histone acetyltransferase KAT2A
11	9606.ENSP00000430432	0.918	Histone deacetylase 2
12	9606.ENSP00000263857	0.917	DNA-directed RNA polymerase I subunit RPA1
13	9606.ENSP00000388107	0.917	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000303373	0.916	Histone cluster 1 H2A family member e
15	9606.ENSP00000417980	0.916	Histone-lysine N-methyltransferase EHMT1
16	9606.ENSP00000380414	0.915	Protein DEK
17	9606.ENSP00000256442	0.914	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000304697	0.914	Polyubiquitin-B
19	9606.ENSP00000342434	0.914	Tyrosine-protein kinase BAZ1B
20	9606.ENSP00000444136	0.914	DNA-directed RNA polymerase I subunit RPA2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.618	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042742	0.998	defense response to bacterium
GO:0002376	0.995	immune system process
GO:0006959	0.994	humoral immune response
GO:0002251	0.994	organ or tissue specific immune response
GO:0061844	0.966	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0002385	0.954	mucosal immune response
GO:0050830	0.950	defense response to Gram-positive bacterium
GO:0019731	0.929	antibacterial humoral response
GO:0009987	0.695	cellular process
GO:0045087	0.525	innate immune response
GO:0065007	0.473	biological regulation
GO:0050789	0.379	regulation of biological process
GO:0050794	0.373	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.989	cytosol
GO:0043232	0.882	intracellular non-membrane-bounded organelle
GO:0005576	0.399	extracellular region
GO:0032991	0.385	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]