StarFunc result for job id P57055

User Input

>input (190 residues)
MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEP
RADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESA
SEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVS
SRGGKCSSSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57055	0.999	0.999	4.651E-32	190	1.000	1.000	P57055.pdb.gz	DSCR6_HUMAN Protein ripply3 OS=Homo sapiens OX=9606 GN=RIPPLY3 PE=1 SV=1
2	AFDB:Q924S9	0.296	0.359	1.518E-13	152	0.511	0.638	Q924S9.pdb.gz	DSCR6_MOUSE Protein ripply3 OS=Mus musculus OX=10090 GN=Ripply3 PE=1 SV=2
3	AFDB:Q9NTK1	0.117	0.108	1.661	212	0.179	0.160	Q9NTK1.pdb.gz	DEPP1_HUMAN Protein DEPP1 OS=Homo sapiens OX=9606 GN=DEPP1 PE=1 SV=2
4	PDB:7mr1C	0.138	0.032	2.082	1101	0.058	0.010	7mr1C.pdb.gz
5	PDB:4v6iBO	0.074	0.089	2.228	149	0.058	0.074	4v6iBO.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
6	PDB:6wgi3	0.107	0.038	2.730	637	0.042	0.013	6wgi3.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
7	PDB:7r6qK	0.144	0.101	2.730	286	0.026	0.017	7r6qK.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
8	AFDB:Q582F3	0.150	0.060	3.056	599	0.142	0.045	Q582F3.pdb.gz	Q582F3_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.710 PE=4 SV=1
9	PDB:6mtgB	0.140	0.096	3.126	292	0.068	0.045	6mtgB.pdb.gz
10	PDB:6slmA	0.161	0.064	3.126	539	0.032	0.011	6slmA.pdb.gz	Structure of High-Risk Papillomavirus 31 E6 Oncogenic Protein and Characterization of E6/E6AP/p53 Complex Formation.
11	PDB:3dm0A	0.159	0.050	3.580	675	0.026	0.007	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
12	PDB:3py7A	0.158	0.066	3.580	500	0.026	0.010	3py7A.pdb.gz	Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins.
13	PDB:2h5yB	0.153	0.127	4.100	233	0.026	0.021	2h5yB.pdb.gz	Crystallization, data collection and phasing of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri
14	PDB:1r6zZ	0.163	0.070	4.387	499	0.026	0.010	1r6zZ.pdb.gz	The crystal structure of the Argonaute2 PAZ domain reveals an RNA binding motif in RNAi effector complexes.
15	AFDB:H3BTR4	0.116	0.056	7.894	506	0.189	0.071	H3BTR4.pdb.gz	H3BTR4_HUMAN Centromere protein T OS=Homo sapiens OX=9606 GN=CENPT PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57055	5.77e-136	379	190	1.000	1.000	DSCR6_HUMAN Protein ripply3 OS=Homo sapiens OX=9606 GN=RIPPLY3 PE=1 SV=1
2	Q924S9	3.35e-54	171	152	0.521	0.651	DSCR6_MOUSE Protein ripply3 OS=Mus musculus OX=10090 GN=Ripply3 PE=1 SV=2
3	B7XDF1	4.44e-19	82.0	170	0.232	0.259	DSCR6_XENLA Protein ripply3 OS=Xenopus laevis OX=8355 GN=ripply3 PE=1 SV=1
4	Q2WG76	7.16e-16	72.4	128	0.226	0.336	RIPP2_MOUSE Protein ripply2 OS=Mus musculus OX=10090 GN=Ripply2 PE=2 SV=1
5	Q2WG77	5.10e-13	66.6	201	0.184	0.174	RIPP1_MOUSE Protein ripply1 OS=Mus musculus OX=10090 GN=Ripply1 PE=2 SV=1
6	Q5TAB7	1.24e-12	63.9	128	0.174	0.258	RIPP2_HUMAN Protein ripply2 OS=Homo sapiens OX=9606 GN=RIPPLY2 PE=1 SV=1
7	Q2WG80	2.69e-12	63.5	140	0.205	0.279	RIPP1_DANRE Protein ripply1 OS=Danio rerio OX=7955 GN=ripply1 PE=1 SV=1
8	Q2WG78	2.16e-11	60.1	110	0.189	0.327	DSCR6_DANRE Protein ripply3 OS=Danio rerio OX=7955 GN=ripply3 PE=3 SV=1
9	Q0D2K3	1.20e-09	56.6	151	0.158	0.199	RIPP1_HUMAN Protein ripply1 OS=Homo sapiens OX=9606 GN=RIPPLY1 PE=1 SV=1
10	Q8QGU6	1.84e-07	50.1	121	0.153	0.240	LEDGE_XENLA Protein ripply2.1 OS=Xenopus laevis OX=8355 GN=ripply2.1 PE=2 SV=1
11	Q5I2D0	4.25e-05	43.9	154	0.189	0.234	RIPP_BRABE Protein ripply OS=Branchiostoma belcheri OX=7741 GN=RIPPLY PE=2 SV=1
12	Q25QX6	8.20e-05	43.1	153	0.153	0.190	BOWL_XENLA Protein ripply2.2 OS=Xenopus laevis OX=8355 GN=ripply2.2 PE=1 SV=1
13	A0A0C4DG06	0.089	35.4	531	0.137	0.049	A0A0C4DG06_HUMAN Leucine rich pentatricopeptide repeat containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=1
14	B8ZZ38	0.12	35.4	841	0.137	0.031	B8ZZ38_HUMAN Leucine rich pentatricopeptide repeat containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=2
15	C9JCA9	0.12	35.4	837	0.137	0.031	C9JCA9_HUMAN Leucine rich pentatricopeptide repeat containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=2
16	E5KNY5	0.12	35.4	1394	0.137	0.019	E5KNY5_HUMAN Leucine-rich PPR-motif containing OS=Homo sapiens OX=9606 GN=LRPPRC PE=4 SV=1
17	P42704	0.12	35.4	1394	0.137	0.019	LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3
18	Q9LUI2	0.50	33.5	1728	0.084	0.009	NET1A_ARATH Protein NETWORKED 1A OS=Arabidopsis thaliana OX=3702 GN=NET1A PE=1 SV=1
19	H2L3J0	1.0	32.3	1143	0.132	0.022	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
20	Q2TXQ8	1.4	32.0	2121	0.121	0.011	Q2TXQ8_ASPOR Polyketide synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000048 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14998 Ripply	1.2e-28	110.9	Transcription Regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331734

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332513	0.711	SH3 domain-binding glutamic acid-rich protein
2	9606.ENSP00000329915	0.706	Proteasome assembly chaperone 1
3	9606.ENSP00000290399	0.671	Single-minded homolog 2
4	9606.ENSP00000420037	0.625	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
5	9606.ENSP00000477437	0.620	G protein-activated inward rectifier potassium channel 2
6	9606.ENSP00000331791	0.596	T-box transcription factor TBX1
7	9606.ENSP00000278314	0.589	Zinc finger protein 214
8	9606.ENSP00000311399	0.577	Down syndrome critical region gene 3
9	9606.ENSP00000328676	0.566	Down syndrome critical region 4
10	9606.ENSP00000332979	0.552	Beta-secretase 2
11	9606.ENSP00000380759	0.523	Protein arginine N-methyltransferase 2
12	9606.ENSP00000371932	0.519	Taste receptor type 2 member 1
13	9606.ENSP00000207157	0.509	T-box transcription factor TBX15
14	9606.ENSP00000323280	0.502	T-cell differentiation antigen CD6
15	9606.ENSP00000331698	0.501	ATP-sensitive inward rectifier potassium channel 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.955	regulation of metabolic process
GO:0060255	0.954	regulation of macromolecule metabolic process
GO:0032501	0.930	multicellular organismal process
GO:0010468	0.910	regulation of gene expression
GO:0048856	0.909	anatomical structure development
GO:0051171	0.902	regulation of nitrogen compound metabolic process
GO:0080090	0.900	regulation of primary metabolic process
GO:0007275	0.900	multicellular organism development
GO:0031323	0.873	regulation of cellular metabolic process
GO:0019219	0.852	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.834	regulation of RNA metabolic process
GO:0010556	0.797	regulation of macromolecule biosynthetic process
GO:0031326	0.791	regulation of cellular biosynthetic process
GO:0048523	0.787	negative regulation of cellular process
GO:0006355	0.754	regulation of DNA-templated transcription
GO:0031324	0.632	negative regulation of cellular metabolic process
GO:0051172	0.629	negative regulation of nitrogen compound metabolic process
GO:0010605	0.625	negative regulation of macromolecule metabolic process
GO:0051253	0.609	negative regulation of RNA metabolic process
GO:0048731	0.607	system development
GO:0010558	0.493	negative regulation of macromolecule biosynthetic process
GO:0031327	0.489	negative regulation of cellular biosynthetic process
GO:0045892	0.408	negative regulation of DNA-templated transcription
GO:0043009	0.398	chordate embryonic development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.760	nucleoplasm
GO:0043232	0.477	intracellular non-membrane-bounded organelle
GO:0005737	0.462	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]