StarFunc result for job id P57057

User Input

>input (533 residues)
MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEAD
VRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNYQQLLGALDYSFLCAYAVGMYLSGII
GERLPIRYYLTFGMLASGAFTALFGLGYFYNIHSFGFYVVTQVINGLVQTTGWPSVVTCL
GNWFGKGRRGLIMGVWNSHTSVGNILGSLIAGYWVSTCWGLSFVVPGAIVAAMGIVCFLF
LIEHPNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIH
PNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHL
DAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLE
ATIAMLLLSGALVSGPYTLITTAVSADLGTHKSLKGNAHALSTVTAIIDGTGSVGAALGP
LLAGLLSPSGWSNVFYMLMFADACALLFLIRLIHKELSCPGSATGDQVPFKEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57057	1.000	1.000	4.082E-69	533	1.000	1.000	P57057.pdb.gz	G6PT2_HUMAN Glucose-6-phosphate exchanger SLC37A1 OS=Homo sapiens OX=9606 GN=SLC37A1 PE=2 SV=2
2	AFDB:Q7SY29	0.799	0.861	3.775E-45	494	0.565	0.609	Q7SY29.pdb.gz	G6PT3_DANRE Glucose-6-phosphate exchanger SLC37A2 OS=Danio rerio OX=7955 GN=slc37a2 PE=2 SV=1
3	AFDB:Q8TED4	0.806	0.858	4.098E-45	501	0.567	0.603	Q8TED4.pdb.gz	G6PT3_HUMAN Glucose-6-phosphate exchanger SLC37A2 OS=Homo sapiens OX=9606 GN=SLC37A2 PE=2 SV=2
4	AFDB:Q9SL56	0.755	0.816	7.474E-35	493	0.418	0.452	Q9SL56.pdb.gz	GLPT5_ARATH Putative glycerol-3-phosphate transporter 5 OS=Arabidopsis thaliana OX=3702 GN=At2g13100 PE=2 SV=2
5	AFDB:Q9C5L3	0.747	0.761	2.004E-34	523	0.435	0.444	Q9C5L3.pdb.gz	GLPT1_ARATH Putative glycerol-3-phosphate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=At3g47420 PE=2 SV=1
6	AFDB:O23596	0.745	0.730	2.088E-34	544	0.428	0.419	O23596.pdb.gz	GLPT4_ARATH Putative glycerol-3-phosphate transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At4g17550 PE=3 SV=2
7	AFDB:Q9SB41	0.743	0.786	2.667E-33	504	0.422	0.446	Q9SB41.pdb.gz	GLPT2_ARATH Putative glycerol-3-phosphate transporter 2 OS=Arabidopsis thaliana OX=3702 GN=At4g25220 PE=2 SV=1
8	AFDB:Q9SA71	0.721	0.753	4.933E-32	510	0.417	0.435	Q9SA71.pdb.gz	GLPT3_ARATH Putative glycerol-3-phosphate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=At1g30560 PE=3 SV=1
9	AFDB:Q8NCC5	0.734	0.789	8.027E-28	494	0.319	0.344	Q8NCC5.pdb.gz	SPX3_HUMAN Sugar phosphate exchanger 3 OS=Homo sapiens OX=9606 GN=SLC37A3 PE=1 SV=2
10	AFDB:H2FLL7	0.708	0.809	1.422E-25	465	0.289	0.331	H2FLL7.pdb.gz	H2FLL7_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
11	PDB:1pw4A	0.587	0.705	1.668E-11	434	0.178	0.219	1pw4A.pdb.gz
12	PDB:7bc7A	0.548	0.659	3.630E-9	432	0.114	0.141	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
13	PDB:7sptA	0.495	0.550	1.352E-8	470	0.133	0.151	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:6thaA	0.522	0.605	1.594E-8	448	0.124	0.147	6thaA.pdb.gz
15	PDB:4gbyA	0.574	0.635	5.467E-8	475	0.128	0.143	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7zh0A	0.571	0.608	6.995E-8	495	0.118	0.127	7zh0A.pdb.gz
17	PDB:4ybqB	0.523	0.591	7.289E-8	462	0.114	0.132	4ybqB.pdb.gz
18	PDB:3o7qA	0.485	0.601	9.326E-8	414	0.135	0.174	3o7qA.pdb.gz
19	PDB:7aaqA	0.518	0.558	1.013E-7	487	0.120	0.131	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
20	PDB:6oopA	0.566	0.744	2.036E-7	392	0.107	0.145	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57057	0.0	1085	533	1.000	1.000	G6PT2_HUMAN Glucose-6-phosphate exchanger SLC37A1 OS=Homo sapiens OX=9606 GN=SLC37A1 PE=2 SV=2
2	Q7SY29	0.0	597	494	0.572	0.617	G6PT3_DANRE Glucose-6-phosphate exchanger SLC37A2 OS=Danio rerio OX=7955 GN=slc37a2 PE=2 SV=1
3	Q8TED4	0.0	582	501	0.576	0.613	G6PT3_HUMAN Glucose-6-phosphate exchanger SLC37A2 OS=Homo sapiens OX=9606 GN=SLC37A2 PE=2 SV=2
4	Q9C5L3	2.88e-134	401	523	0.450	0.459	GLPT1_ARATH Putative glycerol-3-phosphate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=At3g47420 PE=2 SV=1
5	Q9SL56	1.28e-133	399	493	0.430	0.465	GLPT5_ARATH Putative glycerol-3-phosphate transporter 5 OS=Arabidopsis thaliana OX=3702 GN=At2g13100 PE=2 SV=2
6	O23596	2.22e-133	400	544	0.424	0.415	GLPT4_ARATH Putative glycerol-3-phosphate transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At4g17550 PE=3 SV=2
7	Q9SA71	2.46e-132	396	510	0.424	0.443	GLPT3_ARATH Putative glycerol-3-phosphate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=At1g30560 PE=3 SV=1
8	Q9SB41	1.04e-127	384	504	0.428	0.452	GLPT2_ARATH Putative glycerol-3-phosphate transporter 2 OS=Arabidopsis thaliana OX=3702 GN=At4g25220 PE=2 SV=1
9	Q8NCC5	3.64e-80	261	494	0.326	0.352	SPX3_HUMAN Sugar phosphate exchanger 3 OS=Homo sapiens OX=9606 GN=SLC37A3 PE=1 SV=2
10	H2FLL9	4.27e-71	236	461	0.308	0.356	H2FLL9_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
11	H2FLL7	6.64e-71	236	465	0.308	0.353	H2FLL7_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
12	H2FLL6	2.41e-66	223	452	0.289	0.341	H2FLL6_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
13	O62376	2.77e-66	223	456	0.289	0.338	O62376_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
14	H2FLL8	7.54e-66	220	396	0.255	0.343	H2FLL8_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
15	Q9U372	3.53e-61	208	387	0.248	0.341	Q9U372_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
16	P09836	1.35e-10	65.9	439	0.182	0.221	UHPC_ECOLI Membrane sensor protein UhpC OS=Escherichia coli (strain K12) OX=83333 GN=uhpC PE=1 SV=3
17	O43826	5.39e-09	60.8	429	0.189	0.235	G6PT1_HUMAN Glucose-6-phosphate exchanger SLC37A4 OS=Homo sapiens OX=9606 GN=SLC37A4 PE=1 SV=1
18	Q6NY67	1.95e-08	58.9	429	0.203	0.252	Q6NY67_DANRE Glucose-6-phosphate translocase OS=Danio rerio OX=7955 GN=slc37a4 PE=1 SV=1
19	Q9VKC9	1.24e-06	53.5	496	0.180	0.194	Q9VKC9_DROME Dietary and metabolic glutamate transporter OS=Drosophila melanogaster OX=7227 GN=dmGlut PE=2 SV=2
20	P08194	1.52e-06	53.1	452	0.163	0.192	GLPT_ECOLI Glycerol-3-phosphate transporter OS=Escherichia coli (strain K12) OX=83333 GN=glpT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	3.3e-32	123.4	Major Facilitator Superfamily
2	PF03137 OATP	18	15.1	Organic Anion Transporter Polypeptide (OATP) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379512	0.646	Microsomal glutathione S-transferase 1
2	9606.ENSP00000359376	0.623	Solute carrier family 17 member 9
3	9606.ENSP00000280734	0.615	Lysoplasmalogenase-like protein TMEM86A
4	9606.ENSP00000394899	0.615	Transmembrane protein 51
5	9606.ENSP00000326869	0.609	ORM1-like protein 1
6	9606.ENSP00000369702	0.604	LHFPL tetraspan subfamily member 2 protein
7	9606.ENSP00000284268	0.574	Progressive ankylosis protein homolog
8	9606.ENSP00000355893	0.571	Zinc transporter 10
9	9606.ENSP00000378757	0.560	Monocarboxylate transporter 9
10	9606.ENSP00000266980	0.558	Zinc transporter ZIP5
11	9606.ENSP00000356903	0.553	UDP-N-acetylhexosamine pyrophosphorylase
12	9606.ENSP00000367137	0.553	Probable small intestine urate exporter
13	9606.ENSP00000386935	0.553	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1
14	9606.ENSP00000380184	0.548	Glycerol-3-phosphate acyltransferase 4
15	9606.ENSP00000390564	0.546	Monocarboxylate transporter 6
16	9606.ENSP00000340761	0.543	BRI3-binding protein
17	9606.ENSP00000482264	0.537	Diacylglycerol O-acyltransferase 1
18	9606.ENSP00000261024	0.535	Solute carrier family 40 member 1
19	9606.ENSP00000291536	0.520	Radial spoke head 1 homolog
20	9606.ENSP00000383505	0.519	Kelch domain containing 7A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901505	1.000	carbohydrate derivative transmembrane transporter activity
GO:0015605	1.000	organophosphate ester transmembrane transporter activity
GO:0015114	1.000	phosphate ion transmembrane transporter activity
GO:0005452	1.000	solute:inorganic anion antiporter activity
GO:0015526	0.952	hexose-phosphate:inorganic phosphate antiporter activity
GO:0061513	0.944	glucose 6-phosphate:inorganic phosphate antiporter activity
GO:0005488	0.909	binding
GO:0005515	0.729	protein binding
GO:0008514	0.676	organic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006810	0.983	transport
GO:0055085	0.969	transmembrane transport
GO:0071702	0.922	organic substance transport
GO:1901264	0.909	carbohydrate derivative transport
GO:0015698	0.854	inorganic anion transport
GO:0006817	0.828	phosphate ion transport
GO:0015748	0.805	organophosphate ester transport
GO:0098661	0.734	inorganic anion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005783	0.995	endoplasmic reticulum
GO:0031090	0.988	organelle membrane
GO:0005789	0.951	endoplasmic reticulum membrane
GO:0031982	0.665	vesicle
GO:0071944	0.306	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32823	1.000	phosphate(in) = phosphate(out)

[back to server]