StarFunc result for job id P57071

User Input

>input (1507 residues)
MPRRRPPASGAAQFPERIATRSPDPIPLCTFQRQPRAAPVQPPCRLFFVTFAGCGHRWRS
ESKPGWISRSRSGIALRAARPPGSSPPRPAAPRPPPPGGVVAEAPGDVVIPRPRVQPMRV
ARGGPWTPNPAFREAESWSQIGNQRVSEQLLETSLGNEVSDTEPLSPASAGLRRNPALPP
GPFAQNFSWGNQENLPPALGKIANGGGTGAGKAECGYETESHLLEPHEIPLNVNTHKFSD
CEFPYEFCTVCFSPFKLLGMSGVEGVWNQHSRSASMHTFLNHSATGIREAGCRKDMPVSE
MAEDGSEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSWPASGHVHTQAGQGM
RGYEDRDRADPQQLPEAVPAGLVRRLSGQQLPCRSTLTWGRLCHLVAQGRSSLPPNLEIR
RLEDGAEGVFAITQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDC
NWMMLVRPAAEAEHQNLTAYQHGSDVYFTTSRDIPPGTELRVWYAAFYAKKMDKPMLKQA
GSGVHAAGTPENSAPVESEPSQWACKVCSATFLELQLLNEHLLGHLEQAKSLPPGSQSEA
AAPEKEQDTPRGEPPAVPESENVATKEQKKKPRRGRKPKVSKAEQPLVIVEDKEPTEQVA
EIITEVPPDEPVSATPDERIMELVLGKLATTTTDTSSVPKFTHHQNNTITLKRSLILSSR
HGIRRKLIKQLGEHKRVYQCNICSKIFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESL
KQHVSYKHSRNEVDGEYRYRCGTCEKTFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSN
LSKHKKKHGDKKFACEVCSKMFYRKDVMLDHQRRHLEGVRRVKREDLEAGGENLVRYKKE
PSGCPVCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDD
HQREEFIGKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGY
GCSICNRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTG
VKSHACEQCGKSFARKDMLKEHMRVHDNVREYLCAECGKGMKTKHALRHHMKLHKGIKEY
ECKECHRRFAQKVNMLKHCKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSV
CDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLD
HLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRSHKRKQKPEEEAGAPVPEDATF
SEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAAT
QFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQS
VAHFINLTTLVNSITPLGSQLSDQHPLTWRAVPQTDVLPPSQPQAPPQQAAQPQVQAEQQ
QQQMYSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57071	1.000	1.000	0.000	1507	1.000	1.000	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
2	AFDB:A0A024RC04	0.107	0.183	1.899E-23	805	0.112	0.210	A0A024RC04.pdb.gz
3	AFDB:Q8N1G0	0.048	0.052	2.847E-15	1237	0.129	0.158	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
4	AFDB:A2A7B5	0.044	0.042	5.057E-11	1709	0.142	0.125	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
5	AFDB:M9NEG1	0.053	0.070	2.370E-10	1109	0.106	0.144	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
6	AFDB:A0A5K4F1D0	0.047	0.034	1.378E-8	2566	0.150	0.088	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
7	AFDB:Q5BIH1	0.045	0.077	8.599E-8	803	0.101	0.189	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
8	AFDB:Q96PN7	0.041	0.046	1.021E-7	1200	0.135	0.169	Q96PN7.pdb.gz	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
9	AFDB:A1ZAV3	0.051	0.040	1.212E-7	2171	0.143	0.099	A1ZAV3.pdb.gz	A1ZAV3_DROME Misexpression suppressor of ras 4, isoform A OS=Drosophila melanogaster OX=7227 GN=MESR4 PE=1 SV=1
10	AFDB:P34288	0.050	0.048	1.359E-7	1605	0.135	0.127	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
11	PDB:5h6zA	0.061	0.586	3.950E-4	123	0.015	0.179	5h6zA.pdb.gz
12	PDB:3w5kB	0.030	0.274	6.244E-4	110	0.025	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:2g46A	0.067	0.660	1.852E-3	119	0.012	0.151	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
14	PDB:5wg6A	0.055	0.152	2.927E-3	517	0.014	0.041	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
15	PDB:7td5F	0.061	0.188	2.927E-3	447	0.013	0.043	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
16	PDB:1pegA	0.049	0.241	3.099E-3	266	0.015	0.086	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
17	PDB:7td5A	0.061	0.171	4.626E-3	497	0.013	0.038	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:7ksoA	0.063	0.219	4.899E-3	395	0.011	0.041	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
19	PDB:3qxyA	0.064	0.205	5.187E-3	420	0.015	0.052	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
20	PDB:5hynA	0.061	0.147	9.734E-3	581	0.013	0.033	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q8T2	0.0	2020	1174	0.651	0.836	PRD15_MOUSE PR domain zinc finger protein 15 OS=Mus musculus OX=10090 GN=Prdm15 PE=1 SV=1
2	P57071	0.0	3153	1507	1.000	1.000	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
3	P17020	4.87e-66	240	682	0.107	0.236	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
4	Q05481	4.90e-64	241	1191	0.115	0.146	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
5	G3V9G6	5.09e-64	235	740	0.109	0.223	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
6	A0A8I6G8Y2	5.37e-64	235	723	0.109	0.228	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
7	Q62788	8.48e-64	234	744	0.109	0.222	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
8	Q5DTF8	1.34e-63	237	919	0.117	0.192	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
9	Q7TPL6	2.82e-63	236	888	0.117	0.198	Q7TPL6_MOUSE Zinc finger protein 748 OS=Mus musculus OX=10090 GN=Zfp748 PE=1 SV=1
10	Q3V1X2	5.13e-63	235	888	0.117	0.198	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
11	Q7TMN8	1.05e-62	227	578	0.109	0.284	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
12	Q8BLA2	3.92e-62	226	578	0.108	0.282	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
13	P35789	1.02e-61	226	620	0.108	0.263	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
14	Q8TAQ5	1.34e-61	227	688	0.107	0.235	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
15	Q8IYB9	1.49e-61	226	648	0.108	0.252	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q9NQV7	5.22e-61	229	894	0.157	0.265	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
17	P51523	5.56e-61	226	738	0.106	0.215	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
18	P17038	1.64e-60	226	809	0.115	0.215	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
19	Q5MCW4	2.44e-60	223	686	0.107	0.235	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
20	Q9UJW7	2.44e-59	223	825	0.108	0.198	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20026 DUF6434	64	15.0	Domain of unknown function (DUF6434)
2	PF00856 SET	6.2	18.7	SET domain
3	PF00096 zf-C2H2	1e-39	143.9	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	2e-36	132.5	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	4.8e-05	34.5	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	6.4e-12	56.7	Zinc-finger double-stranded RNA-binding
7	PF13913 zf-C2HC_2	83	14.5	zinc-finger of a C2HC-type
8	PF13465 zf-H2C2_2	7.5e-26	100.6	Zinc-finger double domain
9	PF12874 zf-met	5e-10	50.6	Zinc-finger of C2H2 type
10	PF18445 zf_PR_Knuckle	0.2	22.8	PR zinc knuckle motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269844

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339764	0.785	PR domain zinc finger protein 8
2	9606.ENSP00000339324	0.749	Small integral membrane protein 15
3	9606.ENSP00000372067	0.613	Protein arginine N-methyltransferase 8
4	9606.ENSP00000382163	0.601	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
5	9606.ENSP00000369853	0.583	C2 calcium dependent domain containing 2
6	9606.ENSP00000291672	0.582	Speriolin-like protein
7	9606.ENSP00000378312	0.575	EF-hand calcium-binding domain-containing protein 5
8	9606.ENSP00000404232	0.568	EF-hand domain-containing family member C2
9	9606.ENSP00000462269	0.549	Zinc finger protein 488
10	9606.ENSP00000374152	0.546	SET and MYND domain-containing protein 5
11	9606.ENSP00000382250	0.544	Mitochondrial ribosomal protein S6
12	9606.ENSP00000332454	0.540	Receptor-interacting serine/threonine-protein kinase 4
13	9606.ENSP00000368528	0.527	MICOS complex subunit MIC26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.977	heterocyclic compound binding
GO:0097159	0.977	organic cyclic compound binding
GO:0003676	0.969	nucleic acid binding
GO:0003677	0.694	DNA binding
GO:0003682	0.654	chromatin binding
GO:0003824	0.585	catalytic activity
GO:0016740	0.506	transferase activity
GO:0043565	0.502	sequence-specific DNA binding
GO:0140110	0.500	transcription regulator activity
GO:0140096	0.475	catalytic activity, acting on a protein
GO:0000976	0.321	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0006355	0.965	regulation of DNA-templated transcription
GO:0009987	0.849	cellular process
GO:0048519	0.480	negative regulation of biological process
GO:0048523	0.468	negative regulation of cellular process
GO:0008152	0.368	metabolic process
GO:0044238	0.347	primary metabolic process
GO:0032502	0.339	developmental process
GO:0048518	0.333	positive regulation of biological process
GO:0071704	0.318	organic substance metabolic process
GO:0032501	0.302	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0016604	0.753	nuclear body
GO:0005737	0.734	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.506	Transferases.

[back to server]