StarFunc result for job id P57075

User Input

>input (661 residues)
MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDH
CNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCE
DQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEA
SLLAGTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKYCSVKPCTKQLHLTLAHK
FYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPG
DYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLN
SRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLVVRHGERVDQIFGKAWLQQCS
TPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFA
SPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNID
TDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLL
GLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISG
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57075	1.000	1.000	0.000	661	1.000	1.000	P57075.pdb.gz	UBS3A_HUMAN Ubiquitin-associated and SH3 domain-containing protein A OS=Homo sapiens OX=9606 GN=UBASH3A PE=1 SV=1
2	AFDB:Q3V3E1	0.457	0.484	0.000	624	0.784	0.830	Q3V3E1.pdb.gz	UBS3A_MOUSE Ubiquitin-associated and SH3 domain-containing protein A OS=Mus musculus OX=10090 GN=Ubash3a PE=1 SV=1
3	AFDB:Q8TF42	0.677	0.689	2.499E-78	649	0.433	0.441	Q8TF42.pdb.gz	UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens OX=9606 GN=UBASH3B PE=1 SV=2
4	AFDB:Q9VCE9	0.442	0.390	9.112E-66	751	0.356	0.313	Q9VCE9.pdb.gz	EPP_DROME Ecdysteroid-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Epp PE=1 SV=1
5	AFDB:Q22323	0.383	0.879	1.114E-25	283	0.141	0.329	Q22323.pdb.gz	STPP_CAEEL Steroid-phosphate phosphatase OS=Caenorhabditis elegans OX=6239 GN=T07F12.1 PE=1 SV=2
6	AFDB:Q7YTB0	0.360	0.702	6.093E-23	331	0.141	0.281	Q7YTB0.pdb.gz	EPP_BOMMO Ecdysteroid-phosphate phosphatase OS=Bombyx mori OX=7091 GN=EPP PE=1 SV=2
7	PDB:2yn2A	0.249	0.607	4.541E-10	254	0.085	0.220	2yn2A.pdb.gz
8	AFDB:Q09676	0.246	0.653	2.828E-9	219	0.071	0.215	Q09676.pdb.gz	YA03_SCHPO Probable phosphatase SPAC5H10.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.03 PE=3 SV=1
9	PDB:6yj6C	0.258	0.488	5.781E-9	330	0.094	0.188	6yj6C.pdb.gz
10	AFDB:Q386M0	0.231	0.382	5.604E-8	383	0.076	0.131	Q386M0.pdb.gz	Q386M0_TRYB2 Phosphoglycerate mutase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0430 PE=4 SV=1
11	AFDB:P36623	0.214	0.595	1.030E-7	211	0.077	0.242	P36623.pdb.gz	PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpm1 PE=1 SV=1
12	AFDB:F4I8M8	0.213	0.399	1.603E-7	332	0.080	0.160	F4I8M8.pdb.gz	GPMA2_ARATH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Arabidopsis thaliana OX=3702 GN=gpmA2 PE=2 SV=1
13	PDB:3dcyA	0.194	0.468	1.884E-7	247	0.079	0.211	3dcyA.pdb.gz
14	PDB:6s2rA	0.222	0.570	3.462E-7	234	0.054	0.154	6s2rA.pdb.gz
15	PDB:3lg2A	0.225	0.516	5.389E-7	269	0.074	0.182	3lg2A.pdb.gz	Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae.
16	PDB:1yjxA	0.217	0.532	5.696E-7	245	0.065	0.176	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
17	PDB:1e58A	0.228	0.566	6.020E-7	247	0.064	0.170	1e58A.pdb.gz
18	PDB:2h4zA	0.214	0.507	6.362E-7	255	0.073	0.188	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
19	PDB:1fztA	0.222	0.628	1.306E-6	211	0.074	0.232	1fztA.pdb.gz
20	PDB:3e9dA	0.205	0.498	1.458E-6	250	0.079	0.208	3e9dA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57075	0.0	1377	661	1.000	1.000	UBS3A_HUMAN Ubiquitin-associated and SH3 domain-containing protein A OS=Homo sapiens OX=9606 GN=UBASH3A PE=1 SV=1
2	Q3V3E1	0.0	1074	624	0.785	0.832	UBS3A_MOUSE Ubiquitin-associated and SH3 domain-containing protein A OS=Mus musculus OX=10090 GN=Ubash3a PE=1 SV=1
3	Q8BGG7	0.0	542	638	0.443	0.459	UBS3B_MOUSE Ubiquitin-associated and SH3 domain-containing protein B OS=Mus musculus OX=10090 GN=Ubash3b PE=1 SV=1
4	Q8TF42	0.0	546	649	0.445	0.453	UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens OX=9606 GN=UBASH3B PE=1 SV=2
5	A0A8I5YC04	3.83e-177	519	600	0.413	0.455	A0A8I5YC04_RAT Ubiquitin associated and SH3 domain containing, B OS=Rattus norvegicus OX=10116 GN=Ubash3b PE=4 SV=1
6	F1LV21	8.65e-172	505	614	0.402	0.433	F1LV21_RAT Ubiquitin associated and SH3 domain containing, B OS=Rattus norvegicus OX=10116 GN=Ubash3b PE=4 SV=3
7	Q9VCE9	4.07e-60	216	751	0.192	0.169	EPP_DROME Ecdysteroid-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Epp PE=1 SV=1
8	Q22323	1.60e-50	179	283	0.148	0.346	STPP_CAEEL Steroid-phosphate phosphatase OS=Caenorhabditis elegans OX=6239 GN=T07F12.1 PE=1 SV=2
9	Q7YTB0	1.33e-41	156	331	0.144	0.287	EPP_BOMMO Ecdysteroid-phosphate phosphatase OS=Bombyx mori OX=7091 GN=EPP PE=1 SV=2
10	Q966U7	6.58e-10	63.2	313	0.044	0.093	Q966U7_DROME CAP, isoform E OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
11	Q8IGB7	7.44e-10	63.5	350	0.044	0.083	Q8IGB7_DROME RH64582p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
12	Q7K1M7	1.08e-09	63.5	500	0.064	0.084	Q7K1M7_DROME CAP, isoform G OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
13	D3DMM3	1.18e-09	63.5	554	0.064	0.076	D3DMM3_DROME CAP, isoform S OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
14	A1Z870	1.22e-09	63.5	565	0.064	0.074	A1Z870_DROME CAP, isoform J OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
15	Q966V0	1.38e-09	63.9	1743	0.044	0.017	Q966V0_DROME CAP, isoform R OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
16	A1Z866	1.40e-09	63.5	639	0.064	0.066	A1Z866_DROME CAP, isoform I OS=Drosophila melanogaster OX=7227 GN=CAP PE=1 SV=1
17	A1Z871	1.42e-09	63.9	1734	0.044	0.017	A1Z871_DROME CAP, isoform B OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
18	Q8IGN4	1.48e-09	63.5	647	0.064	0.065	Q8IGN4_DROME RE58362p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
19	A0A0B4KEJ6	1.60e-09	63.9	1586	0.044	0.018	A0A0B4KEJ6_DROME CAP, isoform W OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
20	Q966U8	1.63e-09	63.2	527	0.044	0.055	Q966U8_DROME DCAPL4 OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00300 His_Phos_1	1.6e-18	78.6	Histidine phosphatase superfamily (branch 1)
2	PF00018 SH3_1	0.048	24.6	SH3 domain
3	PF07653 SH3_2	65	14.8	Variant SH3 domain
4	PF14604 SH3_9	8.2e-10	49.8	Variant SH3 domain
5	PF00627 UBA	12	17.2	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.980	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000441543	0.844	Polyubiquitin-C
3	9606.ENSP00000264972	0.829	Tyrosine-protein kinase ZAP-70
4	9606.ENSP00000046794	0.805	Lymphocyte cytosolic protein 2
5	9606.ENSP00000354972	0.726	N-alpha-acetyltransferase 35, NatC auxiliary subunit
6	9606.ENSP00000442600	0.726	Dystroglycan
7	9606.ENSP00000275493	0.721	Epidermal growth factor receptor
8	9606.ENSP00000352833	0.691	Tyrosine-protein phosphatase non-receptor type 22
9	9606.ENSP00000342681	0.648	T-cell surface glycoprotein CD5
10	9606.ENSP00000300692	0.644	T-cell surface glycoprotein CD3 delta chain
11	9606.ENSP00000354782	0.634	T-cell surface glycoprotein CD3 zeta chain
12	9606.ENSP00000338812	0.625	Complement C1q tumor necrosis factor-related protein 6
13	9606.ENSP00000412189	0.615	Phosphoglycerate mutase family member 4
14	9606.ENSP00000293760	0.598	LEM domain-containing protein 2
15	9606.ENSP00000295756	0.588	T-cell receptor-associated transmembrane adapter 1
16	9606.ENSP00000359991	0.585	Phosphoglycerate mutase 1
17	9606.ENSP00000354566	0.584	T-cell surface glycoprotein CD3 epsilon chain
18	9606.ENSP00000305529	0.575	Signal-regulatory protein gamma
19	9606.ENSP00000311857	0.573	Tyrosine-protein phosphatase non-receptor type 2
20	9606.ENSP00000345492	0.571	SH2B adapter protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.814	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0048583	0.991	regulation of response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0048519	0.974	negative regulation of biological process
GO:0023051	0.949	regulation of signaling
GO:0002682	0.906	regulation of immune system process
GO:0010646	0.865	regulation of cell communication
GO:0019222	0.820	regulation of metabolic process
GO:0060255	0.810	regulation of macromolecule metabolic process
GO:0009987	0.771	cellular process
GO:0048523	0.711	negative regulation of cellular process
GO:0009966	0.710	regulation of signal transduction
GO:0051239	0.610	regulation of multicellular organismal process
GO:0008152	0.561	metabolic process
GO:0048585	0.552	negative regulation of response to stimulus
GO:0010468	0.497	regulation of gene expression
GO:0050776	0.451	regulation of immune response
GO:0050896	0.423	response to stimulus
GO:0002683	0.399	negative regulation of immune system process
GO:0071704	0.395	organic substance metabolic process
GO:0023057	0.389	negative regulation of signaling
GO:0010648	0.360	negative regulation of cell communication
GO:0044238	0.354	primary metabolic process
GO:0009968	0.353	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0012505	0.997	endomembrane system
GO:0005654	0.996	nucleoplasm
GO:0005576	0.992	extracellular region
GO:0031982	0.991	vesicle
GO:1903561	0.980	extracellular vesicle
GO:0005615	0.969	extracellular space
GO:0070062	0.960	extracellular exosome
GO:0005794	0.911	Golgi apparatus
GO:0071944	0.479	cell periphery
GO:0016020	0.376	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]