StarFunc result for job id P57078

User Input

>input (832 residues)
MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDD
RERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFR
IIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDG
LFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGH
RPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELIRQVLAALLPVTGRW
RSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLDVKSPPEPRSE
VVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLS
GVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVD
LALDSGASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLA
RKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENI
VRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAA
QRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYT
ALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFD
EQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57078	1.000	1.000	0.000	832	1.000	1.000	P57078.pdb.gz	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
2	AFDB:Q9ERK0	0.459	0.486	1.388E-94	786	0.844	0.893	Q9ERK0.pdb.gz	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
3	AFDB:Q8BZ25	0.385	0.427	5.311E-45	745	0.328	0.366	Q8BZ25.pdb.gz	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
4	AFDB:Q8NFD2	0.387	0.418	1.847E-44	765	0.347	0.378	Q8NFD2.pdb.gz	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
5	AFDB:Q80YE7	0.341	0.204	3.300E-25	1442	0.190	0.110	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
6	PDB:8cs9A	0.424	0.443	2.784E-21	796	0.153	0.160	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	AFDB:Q54KA7	0.412	0.350	3.786E-21	986	0.133	0.113	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
8	AFDB:Q8N8A2	0.402	0.339	6.773E-21	993	0.138	0.116	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
9	AFDB:P97582	0.414	0.409	2.080E-20	843	0.139	0.138	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
10	AFDB:Q0KIE7	0.349	0.203	5.876E-20	1549	0.138	0.074	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
11	AFDB:O15084	0.334	0.272	1.008E-19	1053	0.145	0.115	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
12	PDB:5vkqA	0.356	0.209	1.435E-14	1499	0.143	0.079	5vkqA.pdb.gz
13	PDB:6lk5A	0.283	0.845	5.327E-13	265	0.090	0.283	6lk5A.pdb.gz
14	PDB:4oauC	0.315	0.374	1.931E-12	692	0.105	0.126	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:8dksA	0.268	0.741	5.456E-12	283	0.095	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:2qkwB	0.275	0.722	1.419E-11	292	0.093	0.264	2qkwB.pdb.gz
17	PDB:4btfA	0.273	0.524	1.607E-11	413	0.084	0.169	4btfA.pdb.gz
18	PDB:4k2rA	0.276	0.406	3.689E-11	551	0.093	0.140	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:2h8hA	0.282	0.507	3.845E-11	445	0.091	0.171	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:6s73A	0.269	0.781	5.589E-11	269	0.070	0.216	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57078	0.0	1703	832	1.000	1.000	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
2	Q9ERK0	0.0	1414	786	0.855	0.905	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
3	Q9H4D1	0.0	1579	784	0.940	0.997	Q9H4D1_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=dik PE=2 SV=1
4	Q8NFD2	2.86e-80	276	765	0.181	0.197	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
5	Q8BZ25	4.44e-77	267	745	0.171	0.191	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
6	A0A060WPC3	1.14e-57	209	589	0.144	0.204	A0A060WPC3_ONCMY Receptor-interacting serine/threonine-protein kinase 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00058388001 PE=4 SV=1
7	Q4V958	1.05e-56	207	584	0.137	0.195	Q4V958_DANRE Receptor-interacting serine/threonine-protein kinase 2 OS=Danio rerio OX=7955 GN=RICK PE=2 SV=1
8	P58801	2.45e-56	204	539	0.141	0.217	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
9	A0A0S2Z4Z8	6.70e-55	201	540	0.144	0.222	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
10	O43353	6.70e-55	201	540	0.144	0.222	RIPK2_HUMAN Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2
11	Q0KIE7	1.61e-52	201	1549	0.145	0.078	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
12	Q24241	2.53e-52	201	1549	0.145	0.078	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
13	O70511	4.52e-49	191	2622	0.159	0.050	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
14	Q12955	4.92e-49	191	4377	0.154	0.029	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
15	Q02357	3.88e-47	185	1862	0.151	0.068	ANK1_MOUSE Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2
16	Q7KU92	5.11e-47	185	4083	0.153	0.031	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
17	X2JC49	5.33e-47	184	4233	0.153	0.030	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	M9MRX4	5.45e-47	185	13559	0.153	0.009	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	A8JNM7	5.49e-47	184	4114	0.153	0.031	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	M9MRR4	5.67e-47	184	4223	0.153	0.030	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.5	17.9	ABC1 atypical kinase-like domain
2	PF00023 Ank	2e-56	197.4	Ankyrin repeat
3	PF12796 Ank_2	2.2e-75	260.6	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	5.9e-47	163.0	Ankyrin repeat
5	PF13637 Ank_4	1.5e-54	193.0	Ankyrin repeats (many copies)
6	PF13857 Ank_5	3e-45	162.9	Ankyrin repeats (many copies)
7	PF00069 Pkinase	9e-41	151.6	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	4.3e-38	142.7	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000023719

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000036003	0.837	LIM and senescent cell antigen-like-containing domain protein
2	9544.ENSMMUP00000040743	0.823	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
3	9544.ENSMMUP00000022260	0.780	Cyclin G associated kinase
4	9544.ENSMMUP00000019658	0.744	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
5	9544.ENSMMUP00000039086	0.737	Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
6	9544.ENSMMUP00000024306	0.722	Conserved helix-loop-helix ubiquitous kinase
7	9544.ENSMMUP00000025265	0.699	E3 ubiquitin-protein ligase TRAF7
8	9544.ENSMMUP00000010949	0.697	Inhibitor of nuclear factor kappa-B kinase subunit beta isoform 1
9	9544.ENSMMUP00000037540	0.691	RELA proto-oncogene, NF-kB subunit
10	9544.ENSMMUP00000038253	0.686	Interferon regulatory factor 6 isoform 1
11	9544.ENSMMUP00000012271	0.685	Baculoviral IAP repeat containing 6
12	9544.ENSMMUP00000010063	0.677	Serine/threonine-protein kinase TBK1
13	9544.ENSMMUP00000038190	0.677	Inhibitor of nuclear factor kappa B kinase subunit epsilon
14	9544.ENSMMUP00000017013	0.671	Mindbomb E3 ubiquitin protein ligase 2
15	9544.ENSMMUP00000031893	0.662	Mitogen-activated protein kinase kinase 7
16	9544.ENSMMUP00000022909	0.661	Ligand of numb-protein X 1, E3 ubiquitin protein ligase
17	9544.ENSMMUP00000016018	0.659	CYLD lysine 63 deubiquitinase
18	9544.ENSMMUP00000030148	0.658	Drebrin 1
19	9544.ENSMMUP00000000496	0.648	Tumor necrosis factor receptor superfamily, member 1A
20	9544.ENSMMUP00000039382	0.648	Membrane associated guanylate kinase, WW and PDZ domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016301	0.956	kinase activity
GO:0140096	0.952	catalytic activity, acting on a protein
GO:0016773	0.946	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.940	protein kinase activity
GO:0004674	0.925	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.963	cellular process
GO:0050794	0.962	regulation of cellular process
GO:0044237	0.821	cellular metabolic process
GO:0032502	0.793	developmental process
GO:0048856	0.782	anatomical structure development
GO:0019222	0.647	regulation of metabolic process
GO:0065009	0.591	regulation of molecular function
GO:0009889	0.565	regulation of biosynthetic process
GO:0031323	0.560	regulation of cellular metabolic process
GO:0060255	0.550	regulation of macromolecule metabolic process
GO:0051171	0.519	regulation of nitrogen compound metabolic process
GO:0080090	0.518	regulation of primary metabolic process
GO:0010468	0.482	regulation of gene expression
GO:0019219	0.471	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.469	regulation of macromolecule biosynthetic process
GO:0031326	0.468	regulation of cellular biosynthetic process
GO:0051252	0.436	regulation of RNA metabolic process
GO:0048519	0.403	negative regulation of biological process
GO:0071704	0.388	organic substance metabolic process
GO:0044238	0.387	primary metabolic process
GO:0009653	0.387	anatomical structure morphogenesis
GO:0051090	0.364	regulation of DNA-binding transcription factor activity
GO:0006807	0.363	nitrogen compound metabolic process
GO:0009888	0.356	tissue development
GO:0048729	0.350	tissue morphogenesis
GO:0044093	0.336	positive regulation of molecular function
GO:0043170	0.321	macromolecule metabolic process
GO:1901564	0.307	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043226	0.944	organelle
GO:0043229	0.928	intracellular organelle
GO:0005634	0.733	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.958	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.946	Phosphotransferases with an alcohol group as acceptor.

[back to server]