StarFunc result for job id P57082

User Input

>input (545 residues)
MLQDKGLSESEEAFRAPGPALGEASAANAPEPALAAPGLSGAALGSPPGPGADVVAAAAA
EQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIV
PADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDP
FGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKI
ENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQAL
QHYQHENGAHSQLAEPQDLPLSTFPTQRDSSLFYHCLKRRDGTRHLDLPCKRSYLEAPSS
VGEDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSGSGPEIAGVSGVDDLPPPPLSCNMW
TSVSPYTSYSVQTMETVPYQPFPTHFTATTMMPRLPTLSAQSSQPPGNAHFSVYNQLSQS
QVRERGPSASFPRERGLPQGCERKPPSPHLNAANEFLYSQTFSLSRESSLQYHSGMGTVE
NWTDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70325	0.471	0.465	1.060E-79	552	0.939	0.928	P70325.pdb.gz	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
2	AFDB:O93288	0.380	0.382	1.972E-73	541	0.848	0.854	O93288.pdb.gz	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
3	AFDB:B3DGX3	0.380	0.381	1.606E-54	543	0.596	0.599	B3DGX3.pdb.gz
4	AFDB:G1K2W9	0.365	0.460	3.749E-39	430	0.382	0.484	G1K2W9.pdb.gz
5	AFDB:Q8AX98	0.343	0.402	4.626E-33	463	0.279	0.328	Q8AX98.pdb.gz	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
6	AFDB:Q8AXX2	0.344	0.406	1.254E-32	460	0.272	0.322	Q8AXX2.pdb.gz	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
7	AFDB:P70323	0.348	0.394	1.496E-32	479	0.306	0.349	P70323.pdb.gz	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
8	AFDB:Q19691	0.341	0.434	3.607E-32	423	0.262	0.338	Q19691.pdb.gz	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
9	AFDB:Q9EPZ6	0.345	0.308	2.813E-31	613	0.334	0.297	Q9EPZ6.pdb.gz	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
10	AFDB:Q24432	0.351	0.202	1.951E-30	972	0.349	0.195	Q24432.pdb.gz	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
11	PDB:7ea3J	0.091	0.061	2.333E-2	883	0.033	0.020	7ea3J.pdb.gz
12	PDB:4ziqA	0.127	0.059	3.956E-2	1450	0.029	0.011	4ziqA.pdb.gz
13	PDB:1yycA	0.099	0.239	4.196E-2	174	0.039	0.121	1yycA.pdb.gz
14	PDB:7tysA	0.122	0.171	4.196E-2	361	0.028	0.042	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
15	PDB:5nzrK	0.076	0.075	5.003E-2	560	0.022	0.021	5nzrK.pdb.gz
16	PDB:5a42A	0.123	0.052	5.306E-2	1597	0.026	0.009	5a42A.pdb.gz
17	PDB:2r51A	0.136	0.222	6.327E-2	288	0.042	0.080	2r51A.pdb.gz
18	PDB:7b0xC	0.109	0.235	6.327E-2	211	0.037	0.095	7b0xC.pdb.gz
19	PDB:5nzrG	0.076	0.056	6.709E-2	798	0.022	0.015	5nzrG.pdb.gz
20	PDB:3fxiC	0.112	0.307	7.545E-2	140	0.029	0.114	3fxiC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R688	0.0	595	543	0.596	0.599	F1R688_DANRE T-box transcription factor 4 OS=Danio rerio OX=7955 GN=tbx4 PE=4 SV=1
2	O93288	0.0	930	541	0.848	0.854	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
3	P57082	0.0	1137	545	1.000	1.000	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
4	P70325	0.0	1053	552	0.939	0.928	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
5	Q9PWE8	0.0	521	521	0.556	0.582	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
6	P70326	3.04e-175	506	518	0.543	0.571	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
7	Q99593	5.29e-175	506	518	0.534	0.562	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2
8	Q5I2P1	6.52e-172	498	517	0.549	0.578	TBX5_RAT T-box transcription factor TBX5 OS=Rattus norvegicus OX=10116 GN=Tbx5 PE=2 SV=1
9	Q9IAK8	1.86e-156	457	492	0.468	0.518	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
10	E3W6T6	3.25e-129	385	422	0.339	0.438	E3W6T6_DANRE T-box 5b isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-114c15.2 PE=2 SV=1
11	Q13207	3.48e-79	265	712	0.222	0.170	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
12	Q19691	4.50e-79	256	423	0.218	0.281	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
13	A0A1D5NXF3	5.94e-79	264	732	0.222	0.165	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
14	Q60707	1.15e-78	263	711	0.222	0.170	TBX2_MOUSE T-box transcription factor TBX2 OS=Mus musculus OX=10090 GN=Tbx2 PE=1 SV=3
15	B0R122	3.55e-78	261	686	0.224	0.178	B0R122_DANRE T-box transcription factor 2a OS=Danio rerio OX=7955 GN=tbx-a PE=4 SV=1
16	B8JKS6	1.57e-77	259	689	0.220	0.174	B8JKS6_DANRE T-box transcription factor 3a OS=Danio rerio OX=7955 GN=tbx-b PE=4 SV=1
17	Q7ZTU9	2.07e-77	259	687	0.218	0.173	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
18	Q8UW76	2.74e-77	252	440	0.211	0.261	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
19	Q9ES03	5.94e-77	251	445	0.209	0.256	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
20	Q9UMR3	1.51e-76	250	447	0.209	0.255	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	4.9e-76	266.3	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264664	0.895	Fibroblast growth factor 10
2	9606.ENSP00000265340	0.876	Pituitary homeobox 1
3	9606.ENSP00000307321	0.800	Homeobox protein Hox-C10
4	9606.ENSP00000446680	0.794	Homeobox protein Hox-C11
5	9606.ENSP00000381382	0.772	Transcription factor 4
6	9606.ENSP00000405574	0.668	F-box-like/WD repeat-containing protein TBL1XR1
7	9606.ENSP00000259989	0.660	Fibroblast growth factor binding protein 2
8	9606.ENSP00000367770	0.617	UDP-xylose and UDP-N-acetylglucosamine transporter
9	9606.ENSP00000302836	0.614	Homeobox protein Hox-C9
10	9606.ENSP00000375067	0.598	Breast carcinoma-amplified sequence 3
11	9606.ENSP00000362634	0.597	Testis-specific serine/threonine-protein kinase 3
12	9606.ENSP00000265007	0.586	Transcription factor SOX-30
13	9606.ENSP00000376322	0.581	Homeobox protein Hox-D13
14	9606.ENSP00000348099	0.574	PDZ and LIM domain protein 7
15	9606.ENSP00000347684	0.564	LIM homeobox transcription factor 1-beta
16	9606.ENSP00000249501	0.560	Homeobox protein Hox-D10
17	9606.ENSP00000006015	0.556	Homeobox protein Hox-A11
18	9606.ENSP00000451207	0.556	Double homeobox 4 like 1
19	9606.ENSP00000297261	0.539	Sonic hedgehog protein
20	9606.ENSP00000249504	0.532	Homeobox protein Hox-D11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.997	DNA binding
GO:1990837	0.991	sequence-specific double-stranded DNA binding
GO:0140110	0.967	transcription regulator activity
GO:0000976	0.967	transcription cis-regulatory region binding
GO:0003700	0.961	DNA-binding transcription factor activity
GO:0000981	0.728	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.617	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.996	anatomical structure development
GO:0007275	0.993	multicellular organism development
GO:0048731	0.928	system development
GO:0009653	0.921	anatomical structure morphogenesis
GO:0065007	0.917	biological regulation
GO:0050789	0.907	regulation of biological process
GO:0048513	0.900	animal organ development
GO:0050794	0.864	regulation of cellular process
GO:0048598	0.812	embryonic morphogenesis
GO:0048518	0.808	positive regulation of biological process
GO:0080090	0.777	regulation of primary metabolic process
GO:0051171	0.777	regulation of nitrogen compound metabolic process
GO:0031323	0.777	regulation of cellular metabolic process
GO:0060255	0.763	regulation of macromolecule metabolic process
GO:0009987	0.741	cellular process
GO:0048522	0.687	positive regulation of cellular process
GO:0060173	0.676	limb development
GO:0030326	0.663	embryonic limb morphogenesis
GO:0019219	0.662	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.661	regulation of macromolecule biosynthetic process
GO:0031326	0.661	regulation of cellular biosynthetic process
GO:0010468	0.647	regulation of gene expression
GO:0006355	0.619	regulation of DNA-templated transcription
GO:0009893	0.548	positive regulation of metabolic process
GO:0010604	0.541	positive regulation of macromolecule metabolic process
GO:0051173	0.496	positive regulation of nitrogen compound metabolic process
GO:0045935	0.493	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.463	positive regulation of biosynthetic process
GO:0006357	0.451	regulation of transcription by RNA polymerase II
GO:0009888	0.445	tissue development
GO:0031328	0.432	positive regulation of cellular biosynthetic process
GO:0010557	0.431	positive regulation of macromolecule biosynthetic process
GO:0051254	0.404	positive regulation of RNA metabolic process
GO:0045893	0.378	positive regulation of DNA-templated transcription
GO:0045944	0.342	positive regulation of transcription by RNA polymerase II
GO:0048519	0.328	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.965	nuclear lumen
GO:0005654	0.934	nucleoplasm
GO:0043232	0.823	intracellular non-membrane-bounded organelle
GO:0032991	0.341	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]