StarFunc result for job id P57086

User Input

>input (179 residues)
MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEA
IPTPRAAASAALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAA
GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NZG6	0.449	0.378	5.466E-22	217	1.000	0.825	Q9NZG6.pdb.gz	Q9NZG6_HUMAN SCAN-related protein RAZ1 (Fragment) OS=Homo sapiens OX=9606 GN=RAZ1 PE=2 SV=1
2	AFDB:Q571L0	0.428	0.426	5.608E-13	180	0.547	0.544	Q571L0.pdb.gz	Q571L0_MOUSE MKIAA4092 protein (Fragment) OS=Mus musculus OX=10090 GN=Scand1 PE=2 SV=1
3	AFDB:Q8C2P0	0.376	0.441	2.471E-10	152	0.436	0.513	Q8C2P0.pdb.gz	Q8C2P0_MOUSE SCAN box domain-containing protein OS=Mus musculus OX=10090 GN=Scand1 PE=2 SV=1
4	AFDB:Q53GI3	0.331	0.113	1.674E-6	561	0.274	0.087	Q53GI3.pdb.gz	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
5	AFDB:Q8CF60	0.340	0.096	6.147E-5	680	0.251	0.066	Q8CF60.pdb.gz	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
6	AFDB:Q07231	0.323	0.107	7.881E-5	555	0.285	0.092	Q07231.pdb.gz	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
7	AFDB:Q9P0L1	0.337	0.085	8.386E-5	754	0.235	0.056	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
8	AFDB:P17040	0.358	0.066	1.010E-4	1043	0.274	0.047	P17040.pdb.gz	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
9	AFDB:P17029	0.327	0.109	2.129E-4	563	0.251	0.080	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
10	AFDB:Q8R2V3	0.342	0.071	2.266E-4	986	0.229	0.042	Q8R2V3.pdb.gz	ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus OX=10090 GN=Znf445 PE=2 SV=2
11	PDB:1tndA	0.106	0.072	2.582	323	0.050	0.028	1tndA.pdb.gz	The 2.2 A crystal structure of transducin-alpha complexed with GTP gamma S.
12	PDB:6bgeA	0.121	0.070	6.556	323	0.045	0.025	6bgeA.pdb.gz	CagAlpha in complex with hexamer inhibitor
13	PDB:7peqAJ	0.101	0.032	7.423	996	0.067	0.012	7peqAJ.pdb.gz
14	PDB:5nrlM	0.083	0.085	7.899	174	0.078	0.080	5nrlM.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:6so5C	0.138	0.160	8.405	144	0.028	0.035	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
16	PDB:3ayhA	0.107	0.129	8.944	134	0.089	0.119	3ayhA.pdb.gz
17	PDB:6lqsRP	0.181	0.021	8.944	2180	0.056	0.005	6lqsRP.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
18	PDB:5ls9F	0.120	0.127	9.517	165	0.045	0.048	5ls9F.pdb.gz	Humanized archaeal ferritin as a tool for cell targeted delivery.
19	PDB:6q56A	0.148	0.115	9.517	234	0.034	0.026	6q56A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57086	7.02e-121	340	179	1.000	1.000	SCND1_HUMAN SCAN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCAND1 PE=1 SV=1
2	Q9NZG6	5.94e-120	339	217	1.000	0.825	Q9NZG6_HUMAN SCAN-related protein RAZ1 (Fragment) OS=Homo sapiens OX=9606 GN=RAZ1 PE=2 SV=1
3	Q2M4I6	1.01e-46	151	142	0.559	0.704	Q2M4I6_MOUSE SCAN domain-containing 1 OS=Mus musculus OX=10090 GN=Scand1 PE=1 SV=1
4	Q9Z0V9	1.42e-46	151	142	0.559	0.704	Q9Z0V9_MOUSE Leucine-rich-domain inter-acting protein 1 OS=Mus musculus OX=10090 GN=Scand1 PE=2 SV=1
5	Q571L0	3.02e-46	151	180	0.559	0.556	Q571L0_MOUSE MKIAA4092 protein (Fragment) OS=Mus musculus OX=10090 GN=Scand1 PE=2 SV=1
6	Q8C2P0	1.11e-41	139	152	0.464	0.546	Q8C2P0_MOUSE SCAN box domain-containing protein OS=Mus musculus OX=10090 GN=Scand1 PE=2 SV=1
7	Q6NSZ9	4.01e-22	94.4	544	0.235	0.077	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
8	Q8IWY8	8.53e-22	93.6	852	0.229	0.048	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
9	Q15776	8.67e-22	93.6	578	0.235	0.073	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
10	Q91VN1	3.45e-21	90.9	368	0.229	0.111	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
11	Q3ZBY5	4.08e-21	91.3	466	0.240	0.092	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
12	P17028	5.72e-21	90.1	368	0.229	0.111	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
13	P17040	5.74e-21	91.3	1043	0.240	0.041	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
14	Q6P088	6.49e-21	88.2	244	0.223	0.164	Q6P088_HUMAN ZNF483 protein OS=Homo sapiens OX=9606 GN=ZNF483 PE=1 SV=1
15	P17029	8.13e-21	90.9	563	0.218	0.069	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
16	Q86W11	9.82e-21	90.5	494	0.218	0.079	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
17	Q96N95	1.54e-20	88.6	335	0.223	0.119	ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens OX=9606 GN=ZNF396 PE=1 SV=2
18	Q9Y5A6	2.94e-20	89.0	473	0.223	0.085	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
19	Q9CTS7	3.47e-20	85.9	229	0.212	0.166	Q9CTS7_MOUSE SCAN box domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp449 PE=2 SV=1
20	Q6R2W3	5.55e-20	88.6	1325	0.229	0.031	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02023 SCAN	2.5e-22	89.8	SCAN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302310	0.879	Zinc finger protein 396
2	9606.ENSP00000259883	0.875	PiggyBac transposable element-derived protein 1
3	9606.ENSP00000331577	0.873	Zinc finger protein 397
4	9606.ENSP00000261332	0.872	Zinc finger protein 24
5	9606.ENSP00000380057	0.872	Zinc finger and SCAN domain-containing protein 32
6	9606.ENSP00000338860	0.849	Zinc finger protein 444
7	9606.ENSP00000355053	0.838	Zinc finger and SCAN domain-containing protein 20
8	9606.ENSP00000366509	0.827	Zinc finger protein with KRAB and SCAN domains 4
9	9606.ENSP00000332433	0.743	Zinc finger and SCAN domain-containing protein 22
10	9606.ENSP00000273320	0.707	Zinc finger protein with KRAB and SCAN domains 7
11	9606.ENSP00000337363	0.678	Zinc finger protein 394
12	9606.ENSP00000470123	0.660	Zinc finger and SCAN domain-containing protein 18
13	9606.ENSP00000315664	0.621	Zinc finger protein 18
14	9606.ENSP00000337724	0.612	Zinc finger protein 202
15	9606.ENSP00000326200	0.591	Zinc finger and BTB domain-containing protein 11
16	9606.ENSP00000428223	0.587	Ribosomal protein L26 like 1
17	9606.ENSP00000445768	0.585	Protein LCHN
18	9606.ENSP00000484931	0.520	Zinc finger and SCAN domain-containing protein 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0009889	0.964	regulation of biosynthetic process
GO:0006355	0.927	regulation of DNA-templated transcription
GO:1903508	0.920	positive regulation of nucleic acid-templated transcription
GO:0045893	0.914	positive regulation of DNA-templated transcription
GO:0009987	0.569	cellular process
GO:0048523	0.344	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.965	nuclear lumen
GO:0005737	0.720	cytoplasm
GO:0005654	0.448	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]