StarFunc result for job id P57088

User Input

>input (247 residues)
MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALL
ANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSL
LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQG
SLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFIS
RLAPTVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57088	1.000	1.000	2.015E-32	247	1.000	1.000	P57088.pdb.gz	TMM33_HUMAN Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2
2	AFDB:Q9V447	0.946	0.849	9.090E-18	276	0.413	0.370	Q9V447.pdb.gz	KRH2_DROME Krueppel homolog 2 OS=Drosophila melanogaster OX=7227 GN=Kr-h2 PE=1 SV=1
3	AFDB:Q9M898	0.758	0.550	1.259E-8	348	0.182	0.129	Q9M898.pdb.gz	Q9M898_ARATH AT3g02420/F16B3_5 OS=Arabidopsis thaliana OX=3702 GN=At3g02420 PE=1 SV=1
4	AFDB:Q12164	0.764	0.685	1.388E-7	279	0.194	0.172	Q12164.pdb.gz	POM33_YEAST Pore membrane protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POM33 PE=1 SV=1
5	AFDB:Q9Y7Z5	0.792	0.711	1.831E-7	279	0.170	0.151	Q9Y7Z5.pdb.gz	TTS1_SCHPO Tetra-spanning protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tts1 PE=1 SV=1
6	AFDB:A0A1D8PD79	0.758	0.702	1.530E-6	269	0.170	0.156	A0A1D8PD79.pdb.gz	A0A1D8PD79_CANAL Nucleoporin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C104200CA PE=3 SV=1
7	AFDB:Q12144	0.739	0.677	4.852E-6	273	0.215	0.194	Q12144.pdb.gz	PER33_YEAST Pore and endoplasmic reticulum protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PER33 PE=1 SV=1
8	AFDB:Q38E33	0.729	0.519	8.841E-6	355	0.146	0.101	Q38E33.pdb.gz	Q38E33_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1220 PE=4 SV=1
9	PDB:7f3tA	0.403	0.321	2.206E-1	330	0.101	0.076	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.
10	AFDB:H0Y3P2	0.204	0.091	3.608E-1	869	0.150	0.043	H0Y3P2.pdb.gz	H0Y3P2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
11	PDB:6ww7B	0.169	0.151	4.019E-1	281	0.117	0.103	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
12	AFDB:Q20687	0.213	0.149	5.995E-1	399	0.121	0.075	Q20687.pdb.gz	TM237_CAEEL Transmembrane protein 237 homolog OS=Caenorhabditis elegans OX=6239 GN=jbts-14 PE=3 SV=2
13	PDB:5udkA	0.150	0.092	7.324E-1	461	0.134	0.072	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
14	PDB:5oobF	0.221	0.114	8.033E-1	718	0.077	0.026	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
15	PDB:7vqxR	0.226	0.165	8.412E-1	361	0.109	0.075	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
16	PDB:3msvA	0.220	0.165	1.012	352	0.134	0.094	3msvA.pdb.gz
17	PDB:7y12R	0.201	0.192	1.060	264	0.109	0.102	7y12R.pdb.gz	Structural insight into the activation mechanism of MrgD with heterotrimeric Gi-protein revealed by cryo-EM.
18	PDB:7aqsE	0.204	0.275	1.110	159	0.081	0.126	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.
19	PDB:4qtnC	0.168	0.173	1.217	237	0.130	0.135	4qtnC.pdb.gz	Crystal structure of the Vitamin B3 transporter PnuC
20	PDB:7xw5R	0.194	0.104	1.335	572	0.142	0.061	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57088	0.0	501	247	1.000	1.000	TMM33_HUMAN Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2
2	Q9V447	3.88e-60	192	276	0.417	0.373	KRH2_DROME Krueppel homolog 2 OS=Drosophila melanogaster OX=7227 GN=Kr-h2 PE=1 SV=1
3	Q9Y7Z5	1.11e-04	44.7	279	0.178	0.158	TTS1_SCHPO Tetra-spanning protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tts1 PE=1 SV=1
4	Q12164	0.001	42.0	279	0.126	0.111	POM33_YEAST Pore membrane protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POM33 PE=1 SV=1
5	Q12144	1.7	32.0	273	0.231	0.209	PER33_YEAST Pore and endoplasmic reticulum protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PER33 PE=1 SV=1
6	Q8VWP9	3.0	31.6	535	0.097	0.045	Q8VWP9_GOSHI 3-ketoacyl-CoA synthase OS=Gossypium hirsutum OX=3635 GN=FDH PE=2 SV=1
7	Q7Z6W1	7.9	29.6	182	0.065	0.088	TMCO2_HUMAN Transmembrane and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMCO2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03661 TMEM33_Pom33	1.6e-93	324.1	Transmembrane protein 33/Nucleoporin POM33

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020934

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016513	0.670	Reticulon 1
2	61853.ENSNLEP00000020964	0.648	BEN domain containing 4
3	61853.ENSNLEP00000010748	0.647	Uncharacterized protein
4	61853.ENSNLEP00000014698	0.645	Multiple inositol-polyphosphate phosphatase 1
5	61853.ENSNLEP00000003518	0.637	Cordon-bleu WH2 repeat protein-like 1
6	61853.ENSNLEP00000010182	0.637	ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
7	61853.ENSNLEP00000014089	0.620	Receptor accessory protein 5
8	61853.ENSNLEP00000011474	0.611	Adenosine deaminase domain containing 1 (testis-specific)
9	61853.ENSNLEP00000023942	0.592	Receptor accessory protein 4
10	61853.ENSNLEP00000002660	0.575	Reticulon 2
11	61853.ENSNLEP00000017555	0.574	Nucleoporin 133kDa
12	61853.ENSNLEP00000008624	0.570	Cysteine and histidine-rich domain (CHORD) containing 1
13	61853.ENSNLEP00000010743	0.568	Signal recognition particle subunit SRP72
14	61853.ENSNLEP00000011516	0.568	Spermatogenesis associated 5
15	61853.ENSNLEP00000011525	0.567	Ankyrin repeat domain 50
16	61853.ENSNLEP00000005621	0.566	Reticulon 3
17	61853.ENSNLEP00000002013	0.559	Cancer susceptibility candidate 3
18	61853.ENSNLEP00000004275	0.559	Striatin interacting protein 1
19	61853.ENSNLEP00000020076	0.559	Transmembrane anterior posterior transformation 1
20	61853.ENSNLEP00000020924	0.559	LIM and calponin homology domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048522	0.967	positive regulation of cellular process
GO:0051128	0.908	regulation of cellular component organization
GO:0048583	0.893	regulation of response to stimulus
GO:0050896	0.887	response to stimulus
GO:0033554	0.875	cellular response to stress
GO:1905897	0.837	regulation of response to endoplasmic reticulum stress
GO:0034976	0.831	response to endoplasmic reticulum stress
GO:0009966	0.812	regulation of signal transduction
GO:0048584	0.755	positive regulation of response to stimulus
GO:1900101	0.726	regulation of endoplasmic reticulum unfolded protein response
GO:1905898	0.698	positive regulation of response to endoplasmic reticulum stress
GO:0010647	0.597	positive regulation of cell communication
GO:0023056	0.445	positive regulation of signaling
GO:0008152	0.409	metabolic process
GO:0009967	0.402	positive regulation of signal transduction
GO:0033043	0.398	regulation of organelle organization
GO:0071704	0.362	organic substance metabolic process
GO:0071840	0.323	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	0.998	nuclear envelope
GO:0005789	0.995	endoplasmic reticulum membrane
GO:0031982	0.993	vesicle
GO:0031410	0.970	cytoplasmic vesicle
GO:0048770	0.934	pigment granule
GO:0042470	0.903	melanosome
GO:0005829	0.406	cytosol
GO:0032991	0.367	protein-containing complex
GO:0031981	0.337	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]