StarFunc result for job id P57678

User Input

>input (1058 residues)
MDLGPLNICEEMTILHGGFLLAEQLFHPKALAELTKSDWERVGRPIVEALREISSAAAHS
QPFAWKKKALIIIWAKVLQPHPVTPSDTETRWQEDLFFSVGNMIPTINHTILFELLKSLE
ASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLS
QFSAMAHKYLPALDEFPHPPKRLRSDPDACPTMPLLAMLLRGLTQIQSRILGPGRKCCAL
ANLADMLTVFALTEDDPQEVSATVYLDKLATVISVWNSDTQNPYHQQALAEKVKEAERDV
SLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLRSSQGTSYDSYRLCDSLTSFSQNAT
LYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHME
VCYIFASEKKWAFSDEWVACLGSNRALFRQPDLVLRLLETVIDVSTADRAIPESQIRQVI
HLILECYADLSLPGKNKVLAGILRSWGRKGLSEKLLAYVEGFQEDLNTTFNQLTQSASEQ
GLAKAVASVARLVIVHPEVTVKKMCSLAVVNLGTHKFLAQILTAFPALRFVEEQGPNSSA
TFMVSCLKETVWMKFSTPKEEKQFLELLNCLMSPVKPQGIPVAALLEPDEVLKEFVLPFL
RLDVEEVDLSLRIFIQTLEANACREEYWLQTCSPFPLLFSLCQLLDRFSKYWQLPKEKRC
LSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTVGLRLKSFFEG
HFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDV
GNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLL
NLKPFAQELQLSVLFLRTFQFLCSHSCRDWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAA
GPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNP
SVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57678	1.000	1.000	0.000	1058	1.000	1.000	P57678.pdb.gz	GEMI4_HUMAN Gem-associated protein 4 OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=2
2	AFDB:Q8IRS9	0.380	0.428	2.957E-8	911	0.123	0.143	Q8IRS9.pdb.gz	Q8IRS9_DROME Gemin 4c OS=Drosophila melanogaster OX=7227 GN=Gem4c PE=4 SV=2
3	AFDB:Q6DFV1	0.118	0.113	2.744E-6	1138	0.128	0.119	Q6DFV1.pdb.gz	CNDG2_MOUSE Condensin-2 complex subunit G2 OS=Mus musculus OX=10090 GN=Ncapg2 PE=1 SV=2
4	AFDB:Q86XI2	0.111	0.107	4.486E-6	1143	0.117	0.108	Q86XI2.pdb.gz	CNDG2_HUMAN Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1
5	PDB:7mq8SP	0.141	0.097	4.883E-6	1993	0.138	0.073	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	AFDB:Q387G1	0.122	0.115	1.158E-5	1222	0.117	0.101	Q387G1.pdb.gz	Q387G1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0240 PE=4 SV=1
7	PDB:7kzvV	0.143	0.134	2.061E-5	1155	0.134	0.123	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
8	AFDB:B5X0I6	0.105	0.104	2.103E-5	1091	0.098	0.095	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
9	AFDB:P18296	0.110	0.078	2.103E-5	1828	0.140	0.081	P18296.pdb.gz	CUT1_SCHPO Separin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut1 PE=1 SV=3
10	AFDB:Q28205	0.167	0.152	2.103E-5	1199	0.144	0.127	Q28205.pdb.gz	TBCD_BOVIN Tubulin-specific chaperone D OS=Bos taurus OX=9913 GN=TBCD PE=1 SV=1
11	AFDB:Q9P7V5	0.190	0.137	2.179E-5	1822	0.145	0.084	Q9P7V5.pdb.gz	SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=1 SV=1
12	AFDB:Q960B1	0.122	0.132	2.597E-5	947	0.118	0.132	Q960B1.pdb.gz	Q960B1_DROME SD10334p OS=Drosophila melanogaster OX=7227 GN=unc-45 PE=1 SV=1
13	PDB:7mqaLM	0.160	0.106	3.369E-5	2041	0.147	0.076	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:3s4wB	0.139	0.132	4.160E-5	1146	0.131	0.121	3s4wB.pdb.gz
15	PDB:4bujB	0.118	0.100	4.787E-5	1367	0.107	0.083	4bujB.pdb.gz
16	PDB:6xu2A	0.134	0.132	6.340E-5	1091	0.138	0.134	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
17	PDB:7qdrB	0.110	0.102	1.580E-4	1212	0.129	0.113	7qdrB.pdb.gz
18	PDB:6yj6A	0.108	0.131	1.883E-4	819	0.119	0.154	6yj6A.pdb.gz
19	PDB:3gjxA	0.138	0.139	1.950E-4	1041	0.124	0.126	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
20	PDB:7n85O	0.127	0.099	2.325E-4	1521	0.153	0.107	7n85O.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3L2C7	0.0	2140	1047	0.990	1.000	I3L2C7_HUMAN Gem nuclear organelle associated protein 4 OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=1
2	I3L399	0.0	599	296	0.273	0.976	I3L399_HUMAN Gem nuclear organelle associated protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=1
3	I3L4A4	0.0	547	271	0.250	0.974	I3L4A4_HUMAN Gem nuclear organelle associated protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=1
4	P57678	0.0	2164	1058	1.000	1.000	GEMI4_HUMAN Gem-associated protein 4 OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=2
5	I3L4M4	1.36e-129	392	189	0.179	1.000	I3L4M4_HUMAN Gem nuclear organelle associated protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=1
6	Q9EQJ0	0.74	36.2	817	0.021	0.027	TPC1_MOUSE Two pore calcium channel protein 1 OS=Mus musculus OX=10090 GN=Tpcn1 PE=1 SV=1
7	P0DV10	7.3	32.7	345	0.019	0.058	STING_DROEU Stimulator of interferon genes protein homolog OS=Drosophila eugracilis OX=29029 GN=Sting PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321706

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358716	0.999	Probable ATP-dependent RNA helicase DDX20
2	9606.ENSP00000285873	0.998	Gem-associated protein 5
3	9606.ENSP00000308533	0.997	Gem-associated protein 2
4	9606.ENSP00000281950	0.996	Gem-associated protein 6
5	9606.ENSP00000370083	0.994	Survival of motor neuron 1, telomeric
6	9606.ENSP00000370119	0.991	Survival motor neuron protein
7	9606.ENSP00000270257	0.990	Gem-associated protein 7
8	9606.ENSP00000254301	0.989	Galectin-3
9	9606.ENSP00000220592	0.988	Protein argonaute-2
10	9606.ENSP00000369895	0.986	Gem-associated protein 8
11	9606.ENSP00000392270	0.985	Serine-threonine kinase receptor-associated protein
12	9606.ENSP00000300413	0.949	Small nuclear ribonucleoprotein Sm D1
13	9606.ENSP00000412566	0.949	Small nuclear ribonucleoprotein-associated proteins B and B
14	9606.ENSP00000400591	0.941	Small nuclear ribonucleoprotein E
15	9606.ENSP00000260129	0.940	Trimethylguanosine synthase
16	9606.ENSP00000342374	0.940	Small nuclear ribonucleoprotein Sm D2
17	9606.ENSP00000215829	0.939	Small nuclear ribonucleoprotein Sm D3
18	9606.ENSP00000319169	0.929	Protein arginine N-methyltransferase 5
19	9606.ENSP00000266735	0.927	Small nuclear ribonucleoprotein F
20	9606.ENSP00000272348	0.924	Small nuclear ribonucleoprotein G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043021	1.000	ribonucleoprotein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0022618	0.979	ribonucleoprotein complex assembly
GO:0000398	0.977	mRNA splicing, via spliceosome
GO:0000387	0.974	spliceosomal snRNP assembly
GO:0034660	0.786	ncRNA metabolic process
GO:0034470	0.757	ncRNA processing
GO:0016072	0.630	rRNA metabolic process
GO:0006364	0.619	rRNA processing
GO:0065007	0.480	biological regulation
GO:0050789	0.431	regulation of biological process
GO:0050794	0.393	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016604	1.000	nuclear body
GO:0032991	0.985	protein-containing complex
GO:0043232	0.909	intracellular non-membrane-bounded organelle
GO:0016020	0.857	membrane
GO:1990904	0.847	ribonucleoprotein complex
GO:0140513	0.847	nuclear protein-containing complex
GO:0120114	0.802	Sm-like protein family complex
GO:0005576	0.788	extracellular region
GO:0070062	0.709	extracellular exosome
GO:0005730	0.693	nucleolus
GO:0032797	0.681	SMN complex
GO:0030532	0.681	small nuclear ribonucleoprotein complex
GO:0015030	0.434	Cajal body
GO:0012505	0.358	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]