StarFunc result for job id P57679

User Input

>input (992 residues)
MARGGAACKSDARLLLGRDALRPAPALLAPAVLLGAALGLGLGLWLGCRAGRQRTRHQKD
DTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITAFALKAKVI
YPINQKFRPLADGSSNPSLHENLKQAVLPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHS
ATSDDRFLSRTFLRVNAFPEVLACESVDVDLCIYSLHLKDLLHLDTALRQEKHMMFIQIF
KMCLLDLLPKKKSDDELYQKILSKQEKDLEELEKGLQVKLSNTEMSGAGDSEYITLADVE
KKEREYSEQLIDNMEAFWKQMANIQHFLVDQFKCSSSKARQLMMTLTERMIAAEGLLCDS
QELQALDALERTMGRAHMAKVIEFLKLQVQEETRCRLAAISHGLELLAGEGKLSGRQKEE
LLTQQHKAFWQEAERFSREFVQRGKDLVTASLAHQVEGTAKLTLAQEEEQRSFLAEAQPT
ADPEKFLEAFHEVLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFL
QTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECAL
SSVLQTHLREDHEGTIRGVLGRLGGLTEESTRCVLQGHDLLLRSALRRLALRGNALATLT
QMRLSGKKHLLQELREQRALEQGSSQCLDEHQWQLLRALEARVLEEASRLEEEAQQTRLQ
LQQRLLAEAQEVGQLLQQHMECAIGQALLVHARNAATKSRAKDRDDFKRTLMEAAVESVY
VTSAGVSRLVQAYYQQIGRIMEDHEERKLQHLKTLQGERMENYKLRKKQELSNPSSGSRT
AGGAHETSQAVHQRMLSQQKRFLAQFPVHQQMRLHAQQQQAGVMDLLEAQLETQLQEAEQ
NFISELAALARVPLAESKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNNEDLASGDQT
SGSLSSKRLSQQESEAGDSGNSKKMLKRRSNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57679	1.000	1.000	0.000	992	1.000	1.000	P57679.pdb.gz	EVC_HUMAN EvC complex member EVC OS=Homo sapiens OX=9606 GN=EVC PE=1 SV=1
2	AFDB:G3V706	0.795	0.786	4.108E-88	1003	0.679	0.672	G3V706.pdb.gz	G3V706_RAT EvC ciliary complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Evc PE=4 SV=2
3	AFDB:P57680	0.789	0.779	6.196E-85	1005	0.674	0.666	P57680.pdb.gz	EVC_MOUSE EvC complex member EVC OS=Mus musculus OX=10090 GN=Evc PE=1 SV=2
4	AFDB:Q8K1G2	0.429	0.355	1.228E-10	1220	0.120	0.098	Q8K1G2.pdb.gz	LBN_MOUSE Limbin OS=Mus musculus OX=10090 GN=Evc2 PE=1 SV=1
5	AFDB:Q86UK5	0.399	0.314	1.286E-10	1308	0.119	0.090	Q86UK5.pdb.gz	LBN_HUMAN Limbin OS=Homo sapiens OX=9606 GN=EVC2 PE=1 SV=1
6	AFDB:Q2M1P5	0.104	0.083	1.879E-2	1343	0.133	0.098	Q2M1P5.pdb.gz	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
7	AFDB:P30803	0.090	0.076	3.565E-2	1265	0.119	0.093	P30803.pdb.gz	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
8	AFDB:Q86DA5	0.054	0.054	5.140E-2	981	0.084	0.085	Q86DA5.pdb.gz	SARM1_CAEEL NAD(+) hydrolase tir-1 OS=Caenorhabditis elegans OX=6239 GN=tir-1 PE=1 SV=2
9	AFDB:Q387G6	0.103	0.119	6.172E-2	801	0.104	0.129	Q387G6.pdb.gz	Q387G6_TRYB2 Sodium/hydrogen exchanger OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0300 PE=4 SV=1
10	PDB:6or6A	0.069	0.059	7.828E-2	1264	0.075	0.059	6or6A.pdb.gz
11	PDB:7bc7A	0.074	0.136	9.840E-2	432	0.055	0.127	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
12	AFDB:P58391	0.065	0.082	1.283E-1	732	0.082	0.111	P58391.pdb.gz	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
13	PDB:6wbvA	0.076	0.137	2.046E-1	429	0.043	0.100	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.
14	PDB:6vp9B	0.064	0.068	3.542E-1	914	0.068	0.073	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
15	PDB:6nr7A	0.070	0.066	5.596E-1	1086	0.098	0.089	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
16	PDB:7aaqA	0.072	0.120	8.842E-1	487	0.041	0.084	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:7dl9A	0.070	0.134	9.255E-1	405	0.042	0.104	7dl9A.pdb.gz
18	PDB:5kucA	0.073	0.152	1.014	402	0.049	0.122	5kucA.pdb.gz
19	PDB:6ob6B	0.053	0.113	1.111	357	0.049	0.137	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
20	PDB:7l1kB	0.052	0.068	1.218	660	0.067	0.100	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y1H2	0.0	1245	968	0.667	0.684	A0A8I5Y1H2_RAT EvC ciliary complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Evc PE=4 SV=1
2	G3V706	0.0	1269	990	0.680	0.682	G3V706_RAT EvC ciliary complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Evc PE=4 SV=2
3	P57679	0.0	2014	992	1.000	1.000	EVC_HUMAN EvC complex member EVC OS=Homo sapiens OX=9606 GN=EVC PE=1 SV=1
4	P57680	0.0	1256	1005	0.679	0.671	EVC_MOUSE EvC complex member EVC OS=Mus musculus OX=10090 GN=Evc PE=1 SV=2
5	B9A6K1	1.0	35.8	795	0.022	0.028	B9A6K1_HUMAN TBC1 domain family, member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1
6	Q92609	1.0	35.8	795	0.022	0.028	TBCD5_HUMAN TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1
7	C6CRV0	1.1	35.8	1462	0.033	0.023	XYNA1_PAESJ Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
8	C9J3F6	1.5	35.0	593	0.022	0.037	C9J3F6_HUMAN TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1
9	Q1PFN9	3.0	34.3	564	0.032	0.057	PUM9_ARATH Pumilio homolog 9 OS=Arabidopsis thaliana OX=3702 GN=APUM9 PE=2 SV=1
10	I3VM53	5.6	33.5	1162	0.028	0.024	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
11	Q9Y2K7	5.6	33.5	1162	0.028	0.024	KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=3
12	I3VM54	5.8	33.5	1145	0.028	0.024	I3VM54_HUMAN Lysine demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=1
13	P10189	6.7	33.1	882	0.038	0.043	HELI_HHV11 DNA replication helicase OS=Human herpesvirus 1 (strain 17) OX=10299 GN=HELI PE=3 SV=3
14	P59997	7.0	33.1	1161	0.028	0.024	KDM2A_MOUSE Lysine-specific demethylase 2A OS=Mus musculus OX=10090 GN=Kdm2a PE=1 SV=2
15	P08799	7.3	33.1	2116	0.035	0.017	MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum OX=44689 GN=mhcA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10157 BORCS6	2.3e+02	13.4	BLOC-1-related complex sub-unit 6 C-terminal helix

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342144	0.993	Limbin
2	9606.ENSP00000358918	0.955	Suppressor of fused homolog
3	9606.ENSP00000379258	0.950	Transcriptional activator GLI3
4	9606.ENSP00000390436	0.947	Zinc finger protein GLI2
5	9606.ENSP00000228682	0.945	Zinc finger protein GLI1
6	9606.ENSP00000249373	0.893	Smoothened homolog
7	9606.ENSP00000360129	0.873	EF-hand calcium-binding domain-containing protein 7
8	9606.ENSP00000480715	0.817	IQ domain-containing protein E
9	9606.ENSP00000360316	0.720	Delta(24)-sterol reductase
10	9606.ENSP00000312262	0.699	Beta-adrenergic receptor kinase 1
11	9606.ENSP00000421689	0.680	Casein kinase I isoform alpha
12	9606.ENSP00000388823	0.630	Neuronal vesicle trafficking-associated protein 1
13	9606.ENSP00000381167	0.628	Cytoplasmic dynein 2 heavy chain 1
14	9606.ENSP00000438085	0.588	ADP-ribosylation factor-binding protein GGA3
15	9606.ENSP00000296266	0.565	Intraflagellar transport protein 122 homolog
16	9606.ENSP00000314444	0.561	WD repeat-containing protein 35
17	9606.ENSP00000361800	0.552	WD repeat-containing protein 34
18	9606.ENSP00000385808	0.548	Kinesin-like protein KIF3A
19	9606.ENSP00000265164	0.540	Caspase-6
20	9606.ENSP00000346359	0.520	Protein TALPID3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.935	anatomical structure development
GO:0032501	0.917	multicellular organismal process
GO:0007275	0.756	multicellular organism development
GO:0050789	0.751	regulation of biological process
GO:0050794	0.733	regulation of cellular process
GO:0048513	0.725	animal organ development
GO:0048731	0.640	system development
GO:0001501	0.605	skeletal system development
GO:0009987	0.444	cellular process
GO:0048518	0.327	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060170	1.000	ciliary membrane
GO:0043229	0.976	intracellular organelle
GO:0032991	0.952	protein-containing complex
GO:0043232	0.818	intracellular non-membrane-bounded organelle
GO:0015630	0.746	microtubule cytoskeleton
GO:0005737	0.731	cytoplasm
GO:0005815	0.731	microtubule organizing center
GO:0043231	0.685	intracellular membrane-bounded organelle
GO:0005634	0.374	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]