StarFunc result for job id P57730

User Input

>input (90 residues)
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDL
VTGKGPKSCCKFIKHLCEEDPQLASKMGLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57730	1.000	1.000	5.107E-13	90	1.000	1.000	P57730.pdb.gz	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
2	PDB:1dgnA	0.892	0.902	2.290E-9	89	0.967	0.978	1dgnA.pdb.gz
3	AFDB:P29466	0.980	0.222	4.180E-8	404	0.533	0.119	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
4	AFDB:Q5EG05	0.966	0.446	1.042E-7	197	0.556	0.254	Q5EG05.pdb.gz	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
5	AFDB:Q5XLA6	0.978	0.803	1.563E-7	110	0.544	0.445	Q5XLA6.pdb.gz	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
6	AFDB:P43527	0.982	0.223	2.119E-7	402	0.522	0.117	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
7	AFDB:A0A060XPX2	0.985	0.254	2.596E-7	353	0.489	0.125	A0A060XPX2.pdb.gz	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
8	AFDB:P29452	0.983	0.223	2.731E-7	402	0.522	0.117	P29452.pdb.gz	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
9	AFDB:F7FLN8	0.842	0.126	6.415E-4	638	0.278	0.039	F7FLN8.pdb.gz	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
10	AFDB:A0A0S2Z4Z8	0.826	0.147	1.013E-3	540	0.222	0.037	A0A0S2Z4Z8.pdb.gz	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
11	AFDB:P58801	0.832	0.148	1.121E-3	539	0.222	0.037	P58801.pdb.gz	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
12	PDB:6mksA	0.897	0.897	1.501E-3	90	0.256	0.256	6mksA.pdb.gz
13	PDB:4ikmA	0.878	0.177	2.902E-3	463	0.211	0.041	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
14	PDB:5juyB	0.816	0.067	5.070E-3	1234	0.222	0.016	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
15	PDB:4irlB	0.809	0.173	1.142E-2	463	0.222	0.043	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
16	PDB:6ki0A	0.797	0.167	7.459E-2	459	0.211	0.041	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
17	PDB:2kn6A	0.568	0.293	1.596E-1	195	0.222	0.103	2kn6A.pdb.gz
18	PDB:4a2wA	0.648	0.107	6.281E-1	678	0.144	0.019	4a2wA.pdb.gz
19	PDB:7bxtM	0.556	0.297	1.732	198	0.100	0.045	7bxtM.pdb.gz	Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.
20	PDB:6tnnI	0.249	0.181	2.233	134	0.133	0.090	6tnnI.pdb.gz	Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57730	6.41e-62	184	90	1.000	1.000	CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CARD18 PE=1 SV=1
2	Q5EG05	1.65e-28	103	197	0.556	0.254	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
3	Q5XLA6	6.34e-26	94.0	110	0.544	0.445	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
4	P29466	5.88e-25	97.8	404	0.533	0.119	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
5	P43527	8.10e-22	89.4	402	0.522	0.117	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
6	P29452	9.82e-22	89.0	402	0.522	0.117	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
7	A0A060XPX2	3.97e-18	79.0	353	0.489	0.125	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
8	F7FLN8	3.74e-06	45.4	602	0.289	0.043	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
9	Q5XIW4	3.74e-06	45.4	602	0.289	0.043	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
10	A0A0G2JTI9	3.75e-06	45.4	638	0.289	0.041	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
11	Q9BX69	7.53e-04	38.9	1037	0.256	0.022	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
12	F8W3K2	0.001	38.1	980	0.300	0.028	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
13	O08863	0.001	38.5	600	0.267	0.040	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
14	Q9NPP4	0.041	33.9	1024	0.244	0.021	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
15	Q9Y2G2	0.29	31.6	537	0.211	0.035	CARD8_HUMAN Caspase recruitment domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CARD8 PE=1 SV=2
16	E9PMT1	1.0	29.6	147	0.211	0.129	E9PMT1_HUMAN Caspase 4 (Fragment) OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
17	D4A5W3	1.3	29.6	932	0.200	0.019	D4A5W3_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=1
18	P49662	1.3	29.6	377	0.211	0.050	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
19	Q80SY9	1.3	29.6	1013	0.200	0.018	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
20	Q8K3Z0	1.3	29.6	1020	0.200	0.018	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.9e-23	93.6	Caspase recruitment domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.949	Caspase-1
2	9606.ENSP00000364859	0.845	Caspase recruitment domain-containing protein 17
3	9606.ENSP00000364858	0.807	Caspase recruitment domain-containing protein 16
4	9606.ENSP00000482325	0.635	Ankyrin repeat domain-containing protein 20A3
5	9606.ENSP00000448165	0.609	Apoptotic protease-activating factor 1
6	9606.ENSP00000375767	0.593	Caspase recruitment domain-containing protein 8
7	9606.ENSP00000477695	0.530	Ankyrin repeat domain-containing protein 20A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.999	protein domain specific binding
GO:0089720	0.999	caspase binding
GO:0050700	0.839	CARD domain binding
GO:0042802	0.813	identical protein binding
GO:0098772	0.350	molecular function regulator activity
GO:0030234	0.334	enzyme regulator activity
GO:0061134	0.324	peptidase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:2000116	0.993	regulation of cysteine-type endopeptidase activity
GO:0044092	0.990	negative regulation of molecular function
GO:0032652	0.988	regulation of interleukin-1 production
GO:0043086	0.975	negative regulation of catalytic activity
GO:0070613	0.971	regulation of protein processing
GO:0032651	0.970	regulation of interleukin-1 beta production
GO:0010951	0.965	negative regulation of endopeptidase activity
GO:0001818	0.963	negative regulation of cytokine production
GO:0010955	0.959	negative regulation of protein processing
GO:0043393	0.952	regulation of protein binding
GO:0032692	0.942	negative regulation of interleukin-1 production
GO:2000117	0.932	negative regulation of cysteine-type endopeptidase activity
GO:0032091	0.928	negative regulation of protein binding
GO:0050896	0.840	response to stimulus
GO:0009987	0.821	cellular process
GO:0009605	0.778	response to external stimulus
GO:0051716	0.755	cellular response to stimulus
GO:0009607	0.749	response to biotic stimulus
GO:0044419	0.716	biological process involved in interspecies interaction between organisms
GO:0051707	0.709	response to other organism
GO:0050794	0.669	regulation of cellular process
GO:0048518	0.580	positive regulation of biological process
GO:0042221	0.539	response to chemical
GO:0042981	0.506	regulation of apoptotic process
GO:0044093	0.470	positive regulation of molecular function
GO:0010033	0.469	response to organic substance
GO:0006950	0.455	response to stress
GO:0048583	0.455	regulation of response to stimulus
GO:0010604	0.431	positive regulation of macromolecule metabolic process
GO:0070887	0.399	cellular response to chemical stimulus
GO:0071216	0.389	cellular response to biotic stimulus
GO:0071310	0.384	cellular response to organic substance
GO:0043281	0.370	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009617	0.355	response to bacterium
GO:0031323	0.353	regulation of cellular metabolic process
GO:0002237	0.353	response to molecule of bacterial origin
GO:0071219	0.330	cellular response to molecule of bacterial origin
GO:0010628	0.326	positive regulation of gene expression
GO:0051173	0.320	positive regulation of nitrogen compound metabolic process
GO:0032496	0.319	response to lipopolysaccharide
GO:0006952	0.315	defense response
GO:0045862	0.312	positive regulation of proteolysis
GO:0032101	0.303	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0110165	0.817	cellular anatomical entity
GO:0005829	0.343	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]