StarFunc result for job id P57738

User Input

>input (103 residues)
MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFY
GNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57738	1.000	1.000	1.736E-16	103	1.000	1.000	P57738.pdb.gz	TCTA_HUMAN T-cell leukemia translocation-altered gene protein OS=Homo sapiens OX=9606 GN=TCTA PE=1 SV=1
2	AFDB:Q08856	0.267	0.118	4.255	258	0.155	0.062	Q08856.pdb.gz	MYF5_CHICK Myogenic factor 5 OS=Gallus gallus OX=9031 GN=MYF5 PE=3 SV=2
3	AFDB:Q45UC9	0.384	0.315	4.958	132	0.107	0.083	Q45UC9.pdb.gz	Q45UC9_ICTPU CD247 antigen like precursor OS=Ictalurus punctatus OX=7998 GN=cd247l PE=2 SV=1
4	AFDB:F4IMB5	0.296	0.060	7.264	777	0.184	0.024	F4IMB5.pdb.gz	F4IMB5_ARATH ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g07698 PE=1 SV=1
5	AFDB:Q06815	0.210	0.064	7.264	381	0.097	0.026	Q06815.pdb.gz	MRL1_YEAST Mannose 6-phosphate receptor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRL1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57738	5.73e-71	208	103	1.000	1.000	TCTA_HUMAN T-cell leukemia translocation-altered gene protein OS=Homo sapiens OX=9606 GN=TCTA PE=1 SV=1
2	P9WM87	4.3	28.5	289	0.165	0.059	Y048_MYCTU Uncharacterized protein Rv0048c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0048c PE=1 SV=1
3	Q20JQ5	4.9	28.5	1932	0.126	0.007	Q20JQ5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn5Laa PE=2 SV=1
4	Q586V6	7.7	27.7	729	0.204	0.029	Q586V6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.420 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20589 DUF6790	2.6e+02	12.8	Family of unknown function (DUF6790)
2	PF15128 T_cell_tran_alt	2.1e-40	147.8	T-cell leukemia translocation-altered

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301917	0.770	Probable G-protein coupled receptor 25
2	9606.ENSP00000394954	0.747	Germ cell-specific gene 1-like protein
3	9606.ENSP00000417378	0.655	ATPase H+ transporting V1 subunit F
4	9606.ENSP00000370047	0.633	Zinc finger protein basonuclin-2
5	9606.ENSP00000367151	0.624	Protocadherin-17
6	9606.ENSP00000394842	0.605	Grancalcin
7	9606.ENSP00000485478	0.568	Cadherin-related family member 1
8	9606.ENSP00000318803	0.565	Synaptotagmin-like protein 2
9	9606.ENSP00000393840	0.554	Biogenesis of lysosome-related organelles complex 1 subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0048856	0.974	anatomical structure development
GO:0030154	0.959	cell differentiation
GO:0050794	0.949	regulation of cellular process
GO:0048468	0.848	cell development
GO:0002761	0.685	regulation of myeloid leukocyte differentiation
GO:0006949	0.679	syncytium formation
GO:0002573	0.679	myeloid leukocyte differentiation
GO:0045670	0.679	regulation of osteoclast differentiation
GO:0045638	0.679	negative regulation of myeloid cell differentiation
GO:1902106	0.679	negative regulation of leukocyte differentiation
GO:0140253	0.575	cell-cell fusion
GO:0030316	0.575	osteoclast differentiation
GO:0002762	0.575	negative regulation of myeloid leukocyte differentiation
GO:0000768	0.523	syncytium formation by plasma membrane fusion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0012505	0.984	endomembrane system
GO:0016020	0.980	membrane
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0005783	0.673	endoplasmic reticulum
GO:0071944	0.587	cell periphery
GO:0005886	0.562	plasma membrane
GO:0031090	0.370	organelle membrane
GO:0042175	0.362	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0070013	0.338	intracellular organelle lumen
GO:0005634	0.306	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]