StarFunc result for job id P57772

User Input

>input (596 residues)
MAGRRVNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFSVPL
PARLRSSLPEFQAAPEAEPEPGEPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVT
KGMQTQSAECLVIGQIACQKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAP
IIPVAAKPGGPEAPETEAPQGIPELIELLTSQISIPTRDPSGPFLMSVDHCFSIKGQGTV
MTGTILSGSISLGDSVEIPALKVVKKVKSMQMFHMPITSAMQGDRLGICVTQFDPKLLER
GLVCAPESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHETVMGRLMFFSPAPDNFDQ
EPILDSFNFSQEYLFQEQYLSKDLTPAVTDNDEADKKAGQATEGHCPRQQWALVEFEKPV
TCPRLCLVIGSRLDADIHTNTCRLAFHGILLHGLEDRNYADSFLPRLKVYKLKHKHGLVE
RAMDDYSVIGRSLFKKETNIQLFVGLKVHLSTGELGIIDSAFGQSGKFKIHIPGGLSPES
KKILTPALKKRARAGRGEATRQEESAERSEPSQHVVLSLTFKRYVFDTHKRMVQSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DEJ5	0.920	0.940	0.000	583	0.888	0.907	B5DEJ5.pdb.gz
2	AFDB:Q9W2H0	0.813	0.944	3.451E-68	511	0.396	0.462	Q9W2H0.pdb.gz	Q9W2H0_DROME Eukaryotic translation elongation factor, selenocysteine-specific OS=Drosophila melanogaster OX=7227 GN=eEFSec PE=2 SV=1
3	AFDB:Q583L1	0.740	0.677	5.556E-59	655	0.399	0.363	Q583L1.pdb.gz	Q583L1_TRYB2 Selenocysteine-tRNA-specific elongation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.70 PE=4 SV=1
4	AFDB:O62108	0.732	0.863	4.345E-49	500	0.272	0.324	O62108.pdb.gz	O62108_CAEEL Tr-type G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=efsc-1 PE=1 SV=2
5	AFDB:Q7K3V6	0.554	0.712	2.023E-29	456	0.161	0.211	Q7K3V6.pdb.gz	Q7K3V6_DROME Elongation factor Tu, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFTu2 PE=1 SV=1
6	AFDB:C2E605	0.544	0.801	4.583E-29	396	0.190	0.285	C2E605.pdb.gz	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
7	AFDB:Q9Y700	0.547	0.730	6.355E-29	439	0.174	0.237	Q9Y700.pdb.gz	EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tuf1 PE=3 SV=1
8	AFDB:Q54HB2	0.549	0.754	8.813E-29	424	0.163	0.229	Q54HB2.pdb.gz	EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=tufm PE=1 SV=2
9	AFDB:P0CE47	0.547	0.808	9.307E-29	394	0.168	0.254	P0CE47.pdb.gz	EFTU1_ECOLI Elongation factor Tu 1 OS=Escherichia coli (strain K12) OX=83333 GN=tufA PE=1 SV=1
10	AFDB:P17745	0.546	0.674	1.363E-28	476	0.168	0.210	P17745.pdb.gz	EFTU_ARATH Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
11	PDB:7a5gZ	0.544	0.797	6.262E-25	394	0.161	0.244	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
12	PDB:1ob2A	0.530	0.779	2.077E-24	393	0.168	0.254	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
13	PDB:6ji2A	0.517	0.699	4.218E-24	432	0.164	0.227	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
14	PDB:5lzbz	0.517	0.503	2.690E-23	614	0.151	0.147	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
15	PDB:5lzwjj	0.488	0.668	3.346E-23	425	0.148	0.207	5lzwjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
16	PDB:7paj9	0.523	0.768	6.093E-23	393	0.180	0.272	7paj9.pdb.gz	Visualizing translation dynamics at atomic detail inside a bacterial cell.
17	PDB:2dcuA	0.490	0.686	2.654E-22	407	0.173	0.253	2dcuA.pdb.gz	Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
18	PDB:7mqaSI	0.557	0.429	5.390E-22	803	0.126	0.093	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7d63RJ	0.544	0.423	7.474E-22	796	0.138	0.103	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
20	PDB:7wtlCL	0.515	0.505	1.095E-21	610	0.144	0.141	7wtlCL.pdb.gz	In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JHW4	0.0	1063	583	0.881	0.901	SELB_MOUSE Selenocysteine-specific elongation factor OS=Mus musculus OX=10090 GN=Eefsec PE=1 SV=2
2	Q9W2H0	2.18e-146	434	511	0.404	0.472	Q9W2H0_DROME Eukaryotic translation elongation factor, selenocysteine-specific OS=Drosophila melanogaster OX=7227 GN=eEFSec PE=2 SV=1
3	Q583L1	2.02e-116	362	655	0.426	0.388	Q583L1_TRYB2 Selenocysteine-tRNA-specific elongation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.29M18.70 PE=4 SV=1
4	O62108	3.28e-67	229	500	0.282	0.336	O62108_CAEEL Tr-type G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=efsc-1 PE=1 SV=2
5	P02992	1.54e-34	138	437	0.169	0.231	EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUF1 PE=1 SV=1
6	C2E605	9.39e-34	135	396	0.169	0.255	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
7	Q74JU6	9.39e-34	135	396	0.169	0.255	EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=tuf PE=3 SV=1
8	P23568	1.66e-33	134	394	0.163	0.246	EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=tuf PE=1 SV=2
9	P50062	3.07e-32	130	394	0.163	0.246	EFTU_BORBU Elongation factor Tu OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=tuf PE=3 SV=1
10	Q9Y700	8.50e-32	130	439	0.159	0.216	EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tuf1 PE=3 SV=1
11	P74227	5.12e-31	127	399	0.151	0.226	EFTU_SYNY3 Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=tuf PE=1 SV=1
12	Q54HB2	2.02e-30	125	424	0.163	0.229	EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=tufm PE=1 SV=2
13	P17745	1.69e-28	121	476	0.166	0.208	EFTU_ARATH Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
14	P0CE47	2.37e-28	119	394	0.158	0.239	EFTU1_ECOLI Elongation factor Tu 1 OS=Escherichia coli (strain K12) OX=83333 GN=tufA PE=1 SV=1
15	P0CE48	2.37e-28	119	394	0.158	0.239	EFTU2_ECOLI Elongation factor Tu 2 OS=Escherichia coli (strain K12) OX=83333 GN=tufB PE=1 SV=1
16	P33166	3.22e-28	119	396	0.158	0.237	EFTU_BACSU Elongation factor Tu OS=Bacillus subtilis (strain 168) OX=224308 GN=tuf PE=1 SV=1
17	P49410	8.88e-28	118	452	0.149	0.197	EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus OX=9913 GN=TUFM PE=1 SV=1
18	Q8BFR5	2.20e-27	117	452	0.146	0.192	EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1
19	P85834	2.37e-27	117	452	0.146	0.192	EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1
20	Q7K3V6	6.31e-27	116	456	0.151	0.197	Q7K3V6_DROME Elongation factor Tu, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFTu2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02492 cobW	0.68	21.0	CobW/HypB/UreG, nucleotide-binding domain
2	PF19993 DO-GTPase2	3.3e+02	12.4	Double-GTPase 2
3	PF16522 FliS_cochap	4.4e+02	12.1	Flagellar FLiS export co-chaperone, HP1076
4	PF00009 GTP_EFTU	2.5e-21	87.6	Elongation factor Tu GTP binding domain
5	PF03144 GTP_EFTU_D2	0.0091	27.7	Elongation factor Tu domain 2
6	PF04670 Gtr1_RagA	1.8e+02	12.9	Gtr1/RagA G protein conserved region
7	PF01926 MMR_HSR1	0.17	23.4	50S ribosome-binding GTPase
8	PF10662 PduV-EutP	67	14.7	Ethanolamine utilisation - propanediol utilisation
9	PF04950 RIBIOP_C	3.9e+02	11.8	40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal
10	PF09439 SRPRB	15	16.4	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364965	0.995	Selenocysteine insertion sequence-binding protein 2
2	9606.ENSP00000357882	0.936	L-seryl-tRNA(Sec) kinase
3	9606.ENSP00000362936	0.912	tRNA selenocysteine 1-associated protein 1
4	9606.ENSP00000367893	0.908	Selenide, water dikinase 1
5	9606.ENSP00000371535	0.864	O-phosphoseryl-tRNA(Sec) selenium transferase
6	9606.ENSP00000234677	0.845	Serine--tRNA ligase, cytoplasmic
7	9606.ENSP00000418669	0.844	Selenide, water dikinase 2
8	9606.ENSP00000355141	0.834	Selenoprotein N
9	9606.ENSP00000428085	0.814	Ribosomal protein L30
10	9606.ENSP00000472847	0.792	Serine--tRNA ligase, mitochondrial
11	9606.ENSP00000269349	0.785	Eukaryotic initiation factor 4A-III
12	9606.ENSP00000420939	0.775	Selenoprotein P
13	9606.ENSP00000254663	0.769	Selenocysteine lyase
14	9606.ENSP00000278572	0.759	40S ribosomal protein S3
15	9606.ENSP00000370625	0.748	DNA-directed RNA polymerase II subunit RPB2
16	9606.ENSP00000444136	0.748	DNA-directed RNA polymerase I subunit RPA2
17	9606.ENSP00000256383	0.737	Eukaryotic translation initiation factor 2 subunit 1
18	9606.ENSP00000453854	0.721	Selenocysteine insertion sequence-binding protein 2-like
19	9606.ENSP00000352927	0.708	Microtubule cross-linking factor 1
20	9606.ENSP00000381282	0.702	Selenoprotein S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	1.000	GTPase activity
GO:0008135	0.998	translation factor activity, RNA binding
GO:0003723	0.997	RNA binding
GO:0044877	0.996	protein-containing complex binding
GO:0017076	0.995	purine nucleotide binding
GO:0035639	0.994	purine ribonucleoside triphosphate binding
GO:0000049	0.991	tRNA binding
GO:0032555	0.989	purine ribonucleotide binding
GO:0032561	0.979	guanyl ribonucleotide binding
GO:0003746	0.975	translation elongation factor activity
GO:0043021	0.827	ribonucleoprotein complex binding
GO:0005525	0.805	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0065007	0.992	biological regulation
GO:0010467	0.988	gene expression
GO:0044260	0.988	cellular macromolecule metabolic process
GO:0019538	0.983	protein metabolic process
GO:0044271	0.981	cellular nitrogen compound biosynthetic process
GO:0009059	0.978	macromolecule biosynthetic process
GO:0006412	0.973	translation
GO:0050789	0.968	regulation of biological process
GO:0010608	0.960	post-transcriptional regulation of gene expression
GO:0050794	0.950	regulation of cellular process
GO:0031323	0.932	regulation of cellular metabolic process
GO:2000112	0.921	regulation of cellular macromolecule biosynthetic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0080090	0.911	regulation of primary metabolic process
GO:0034248	0.897	regulation of amide metabolic process
GO:0006417	0.892	regulation of translation
GO:0006414	0.799	translational elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0032991	0.950	protein-containing complex
GO:0005739	0.720	mitochondrion
GO:1990904	0.568	ribonucleoprotein complex
GO:0070013	0.478	intracellular organelle lumen
GO:0043232	0.351	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]