StarFunc result for job id P57775

User Input

>input (412 residues)
MAAAAGEEEEEEEAARESAARPAAGPALWRLPEELLLLICSYLDMRALGRLAQVCRWLRR
FTSCDLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQ
MPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAG
GDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSGSRDRTAKVWPLASGRLGQCLHT
IQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVM
YESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHLLATGSSYYGV
VRLWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFQNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P57775	1.000	1.000	6.776E-79	412	1.000	1.000	P57775.pdb.gz	FBXW4_HUMAN F-box/WD repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=FBXW4 PE=1 SV=1
2	AFDB:P39014	0.721	0.480	6.597E-23	640	0.235	0.152	P39014.pdb.gz	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1
3	AFDB:P87053	0.722	0.507	8.511E-22	605	0.226	0.154	P87053.pdb.gz	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
4	AFDB:Q8VBV4	0.649	0.401	8.949E-22	710	0.245	0.142	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
5	AFDB:B8A474	0.647	0.376	9.893E-22	760	0.245	0.133	B8A474.pdb.gz
6	AFDB:Q09855	0.714	0.590	8.985E-21	506	0.194	0.158	Q09855.pdb.gz	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
7	AFDB:A0A2R8QFQ6	0.669	0.503	1.281E-19	562	0.187	0.137	A0A2R8QFQ6.pdb.gz	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
8	AFDB:A0A2R8RWN9	0.669	0.528	1.820E-19	534	0.187	0.144	A0A2R8RWN9.pdb.gz	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
9	AFDB:Q5SRY7	0.669	0.521	1.914E-19	542	0.182	0.138	Q5SRY7.pdb.gz	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
10	AFDB:Q93794	0.640	0.470	3.493E-19	587	0.233	0.164	Q93794.pdb.gz	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
11	PDB:6ttuT	0.652	0.678	1.325E-18	394	0.172	0.180	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
12	PDB:5mzhB	0.543	0.540	2.583E-14	415	0.148	0.147	5mzhB.pdb.gz
13	PDB:7mq8LJ	0.608	0.539	4.057E-14	469	0.133	0.117	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7z8bF	0.509	0.468	1.000E-13	457	0.160	0.144	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
15	PDB:7mq8SG	0.586	0.618	1.351E-13	389	0.153	0.162	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7bt6x	0.517	0.444	1.826E-13	488	0.155	0.131	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
17	PDB:7vggA	0.576	0.764	1.826E-13	304	0.129	0.174	7vggA.pdb.gz
18	PDB:4v6wAg	0.599	0.762	2.018E-13	318	0.153	0.198	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:7pzyh	0.586	0.761	2.346E-13	311	0.155	0.206	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:5k1aF	0.588	0.413	2.867E-13	600	0.126	0.087	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57775	0.0	853	412	1.000	1.000	FBXW4_HUMAN F-box/WD repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=FBXW4 PE=1 SV=1
2	Q9JMJ2	0.0	772	410	0.896	0.900	FBXW4_MOUSE F-box/WD repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Fbxw4 PE=1 SV=1
3	Q9VZF4	1.63e-17	87.4	1326	0.235	0.073	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
4	P39014	5.79e-17	85.1	640	0.245	0.158	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1
5	Q6FWR0	3.34e-15	79.7	643	0.141	0.090	Q6FWR0_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TUP1 PE=4 SV=1
6	P16649	1.50e-13	74.7	713	0.133	0.077	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
7	B7ZDC8	1.80e-13	74.3	544	0.250	0.189	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
8	Q969H0	2.96e-13	73.9	707	0.252	0.147	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
9	Q8VBV4	5.11e-13	73.2	710	0.252	0.146	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
10	Q09855	1.29e-12	71.6	506	0.146	0.119	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
11	C8V0I4	1.87e-10	65.1	574	0.155	0.111	C8V0I4_EMENI Transcriptional corepressor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06505 PE=4 SV=1
12	P0CY34	3.29e-10	63.9	512	0.129	0.104	TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUP1 PE=2 SV=1
13	Q93794	1.58e-09	62.0	587	0.165	0.116	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
14	P87053	2.24e-09	61.6	605	0.204	0.139	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
15	Q5U3Q5	4.18e-08	57.8	897	0.131	0.060	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
16	Q54KL5	5.35e-08	56.6	335	0.109	0.134	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
17	Q5A9A6	8.35e-08	57.0	768	0.119	0.064	Q5A9A6_CANAL SCF ubiquitin ligase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC4 PE=4 SV=1
18	Q6PH45	1.06e-07	56.2	507	0.136	0.110	Q6PH45_DANRE PRP4 pre-mRNA-processing factor 4 homolog (yeast) OS=Danio rerio OX=7955 GN=mg:ab03a02 PE=1 SV=1
19	P47025	1.28e-07	56.2	714	0.114	0.066	MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDV1 PE=1 SV=1
20	O43660	1.82e-07	55.5	514	0.126	0.101	PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11795 DUF3322	8.5e+02	11.3	Uncharacterized protein conserved in bacteria N-term (DUF3322)
2	PF00646 F-box	4	18.7	F-box domain
3	PF12937 F-box-like	2.2e-07	42.0	F-box-like
4	PF15966 F-box_4	1.2	20.4	F-box
5	PF00400 WD40	1.4e-08	46.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.935	S-phase kinase-associated protein 1
2	9606.ENSP00000326804	0.925	Cullin-1
3	9606.ENSP00000295688	0.871	T-complex protein 1 subunit gamma
4	9606.ENSP00000317334	0.867	T-complex protein 1 subunit alpha
5	9606.ENSP00000377958	0.866	T-complex protein 1 subunit delta
6	9606.ENSP00000280326	0.865	T-complex protein 1 subunit epsilon
7	9606.ENSP00000286788	0.865	T-complex protein 1 subunit theta
8	9606.ENSP00000258091	0.864	T-complex protein 1 subunit eta
9	9606.ENSP00000264255	0.846	Thioredoxin domain-containing protein 9
10	9606.ENSP00000359170	0.793	Protein DPCD
11	9606.ENSP00000359181	0.785	DNA polymerase lambda
12	9606.ENSP00000299300	0.777	T-complex protein 1 subunit beta
13	9606.ENSP00000359212	0.764	Transcription factor LBX1
14	9606.ENSP00000379025	0.733	F-box/WD repeat-containing protein 10
15	9606.ENSP00000376945	0.716	F-box/WD repeat-containing protein 9
16	9606.ENSP00000275603	0.706	T-complex protein 1 subunit zeta
17	9606.ENSP00000327191	0.682	T-complex protein 1 subunit zeta-2
18	9606.ENSP00000476369	0.677	F-box/WD repeat-containing protein 2
19	9606.ENSP00000264254	0.675	Phosducin-like protein 3
20	9606.ENSP00000016171	0.673	Cytochrome c oxidase assembly protein COX15 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0048522	0.962	positive regulation of cellular process
GO:0009987	0.947	cellular process
GO:0048856	0.925	anatomical structure development
GO:0032501	0.883	multicellular organismal process
GO:0007275	0.870	multicellular organism development
GO:0010464	0.726	regulation of mesenchymal cell proliferation
GO:0060173	0.714	limb development
GO:0061448	0.677	connective tissue development
GO:0048731	0.607	system development
GO:0001501	0.520	skeletal system development
GO:0071704	0.518	organic substance metabolic process
GO:0035107	0.486	appendage morphogenesis
GO:0006807	0.474	nitrogen compound metabolic process
GO:0019222	0.438	regulation of metabolic process
GO:0044238	0.422	primary metabolic process
GO:0035108	0.413	limb morphogenesis
GO:0044237	0.411	cellular metabolic process
GO:0080090	0.404	regulation of primary metabolic process
GO:0031323	0.392	regulation of cellular metabolic process
GO:0043170	0.383	macromolecule metabolic process
GO:0051171	0.353	regulation of nitrogen compound metabolic process
GO:1901564	0.352	organonitrogen compound metabolic process
GO:0019538	0.343	protein metabolic process
GO:0060255	0.326	regulation of macromolecule metabolic process
GO:0044260	0.305	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.857	protein-containing complex
GO:0140535	0.755	intracellular protein-containing complex
GO:1990234	0.607	transferase complex
GO:0031461	0.481	cullin-RING ubiquitin ligase complex
GO:0043226	0.439	organelle
GO:0043229	0.408	intracellular organelle
GO:0043227	0.354	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]