StarFunc result for job id P58004

User Input

>input (480 residues)
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSP
PSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58004	1.000	1.000	1.608E-66	480	1.000	1.000	P58004.pdb.gz	SESN2_HUMAN Sestrin-2 OS=Homo sapiens OX=9606 GN=SESN2 PE=1 SV=1
2	PDB:5cufC	0.714	0.921	1.010E-39	370	0.769	0.997	5cufC.pdb.gz
3	AFDB:P58005	0.832	0.813	1.431E-39	492	0.558	0.545	P58005.pdb.gz	SESN3_HUMAN Sestrin-3 OS=Homo sapiens OX=9606 GN=SESN3 PE=1 SV=2
4	AFDB:P58006	0.847	0.827	1.744E-38	492	0.573	0.559	P58006.pdb.gz	SESN1_MOUSE Sestrin-1 OS=Mus musculus OX=10090 GN=Sesn1 PE=1 SV=3
5	AFDB:Q7ZVJ7	0.786	0.802	1.976E-38	470	0.552	0.564	Q7ZVJ7.pdb.gz
6	AFDB:U3JAG5	0.822	0.725	3.849E-38	547	0.562	0.494	U3JAG5.pdb.gz	U3JAG5_DANRE Sestrin 1 OS=Danio rerio OX=7955 GN=si:ch211-51a19.4 PE=3 SV=1
7	AFDB:Q9W1K5	0.744	0.718	9.622E-30	497	0.410	0.396	Q9W1K5.pdb.gz	SESN_DROME Sestrin homolog OS=Drosophila melanogaster OX=7227 GN=Sesn PE=1 SV=2
8	AFDB:Q54WU6	0.761	0.614	2.079E-23	601	0.292	0.233	Q54WU6.pdb.gz	SESN_DICDI Sestrin homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279427 PE=3 SV=1
9	AFDB:Q388Q1	0.546	0.312	7.639E-12	882	0.208	0.113	Q388Q1.pdb.gz	Q388Q1_TRYB2 PA26 p53-induced protein (Sestrin) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0190 PE=3 SV=1
10	AFDB:Q9BY10	0.115	0.116	4.533E-2	475	0.115	0.116	Q9BY10.pdb.gz	S46A2_HUMAN Solute carrier family 46 member 2 OS=Homo sapiens OX=9606 GN=SLC46A2 PE=2 SV=1
11	AFDB:F1RBC8	0.111	0.084	6.327E-2	766	0.108	0.068	F1RBC8.pdb.gz	ABCD1_DANRE ATP-binding cassette sub-family D member 1 OS=Danio rerio OX=7955 GN=abcd1 PE=2 SV=1
12	PDB:5ykeB	0.102	0.073	3.743E-1	845	0.087	0.050	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
13	PDB:5ykfB	0.094	0.051	4.068E-1	1309	0.087	0.032	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
14	PDB:6s4mA	0.102	0.111	5.678E-1	426	0.119	0.134	6s4mA.pdb.gz
15	PDB:6msmA	0.085	0.054	5.919E-1	1181	0.115	0.047	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
16	PDB:6gs1A	0.107	0.108	6.993E-1	472	0.129	0.131	6gs1A.pdb.gz
17	PDB:6fmrA	0.098	0.098	1.106	475	0.096	0.097	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
18	PDB:5oxpA	0.097	0.099	1.153	462	0.106	0.110	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
19	PDB:7bc7A	0.097	0.104	1.202	432	0.106	0.118	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:7rraA	0.087	0.077	1.307	602	0.092	0.073	7rraA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58004	0.0	994	480	1.000	1.000	SESN2_HUMAN Sestrin-2 OS=Homo sapiens OX=9606 GN=SESN2 PE=1 SV=1
2	P58005	0.0	534	492	0.556	0.543	SESN3_HUMAN Sestrin-3 OS=Homo sapiens OX=9606 GN=SESN3 PE=1 SV=2
3	P58006	0.0	535	492	0.581	0.567	SESN1_MOUSE Sestrin-1 OS=Mus musculus OX=10090 GN=Sesn1 PE=1 SV=3
4	P58043	0.0	916	480	0.915	0.915	SESN2_MOUSE Sestrin-2 OS=Mus musculus OX=10090 GN=Sesn2 PE=1 SV=1
5	Q5RGN4	0.0	538	499	0.575	0.553	Q5RGN4_DANRE Sestrin 1 OS=Danio rerio OX=7955 GN=si:ch211-51a19.4 PE=3 SV=1
6	Q6DG05	0.0	540	488	0.569	0.559	Q6DG05_DANRE Sestrin-1 OS=Danio rerio OX=7955 GN=zgc:91970 PE=2 SV=1
7	Q9CYP7	0.0	530	492	0.556	0.543	SESN3_MOUSE Sestrin-3 OS=Mus musculus OX=10090 GN=Sesn3 PE=1 SV=1
8	Q9Y6P5	0.0	545	492	0.581	0.567	SESN1_HUMAN Sestrin-1 OS=Homo sapiens OX=9606 GN=SESN1 PE=1 SV=2
9	U3JAG5	0.0	538	547	0.569	0.499	U3JAG5_DANRE Sestrin 1 OS=Danio rerio OX=7955 GN=si:ch211-51a19.4 PE=3 SV=1
10	F1R1P4	8.41e-179	511	466	0.544	0.560	F1R1P4_DANRE Sestrin-3 OS=Danio rerio OX=7955 GN=cb261 PE=3 SV=1
11	Q9W1K5	2.73e-126	378	497	0.429	0.414	SESN_DROME Sestrin homolog OS=Drosophila melanogaster OX=7227 GN=Sesn PE=1 SV=2
12	Q54WU6	2.62e-36	143	601	0.144	0.115	SESN_DICDI Sestrin homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279427 PE=3 SV=1
13	Q388Q1	1.01e-09	63.5	882	0.081	0.044	Q388Q1_TRYB2 PA26 p53-induced protein (Sestrin) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0190 PE=3 SV=1
14	A0A0P0X9Z7	0.80	35.0	1600	0.060	0.018	CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF7 PE=1 SV=2
15	F1QB82	2.4	33.1	584	0.050	0.041	F1QB82_DANRE Steroid sulfatase (microsomal), isozyme S OS=Danio rerio OX=7955 GN=sts PE=3 SV=2
16	P37913	5.1	32.3	916	0.035	0.019	DNLI1_MOUSE DNA ligase 1 OS=Mus musculus OX=10090 GN=Lig1 PE=1 SV=2
17	P0C0Y5	5.8	31.6	267	0.058	0.105	MTDH_DAVTA NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana OX=29918 PE=1 SV=1
18	Q8SCY1	7.1	32.0	2237	0.069	0.015	EXLYS_BPDPK Peptidoglycan hydrolase gp181 OS=Pseudomonas phage phiKZ OX=2905945 PE=1 SV=1
19	A2BGT8	8.9	31.6	4611	0.052	0.005	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02627 CMD	23	16.4	Carboxymuconolactone decarboxylase family
2	PF04636 PA26	8.6e-193	652.9	PA26 p53-induced protein (sestrin)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293883	0.992	GATOR complex protein WDR24
2	9606.ENSP00000262144	0.977	GATOR complex protein WDR59
3	9606.ENSP00000339881	0.977	GATOR complex protein MIOS
4	9606.ENSP00000324856	0.976	Serine/threonine-protein kinase STK11
5	9606.ENSP00000362092	0.971	Ras-related GTP-binding protein C
6	9606.ENSP00000369899	0.969	Ras-related GTP-binding protein A
7	9606.ENSP00000262850	0.966	Ras-related GTP-binding protein B
8	9606.ENSP00000269305	0.966	Cellular tumor antigen p53
9	9606.ENSP00000262187	0.962	GTP-binding protein Rheb
10	9606.ENSP00000354558	0.960	Serine/threonine-protein kinase mTOR
11	9606.ENSP00000171111	0.955	Kelch-like ECH-associated protein 1
12	9606.ENSP00000358423	0.955	Ras-related GTP-binding protein D
13	9606.ENSP00000307272	0.951	Regulatory-associated protein of mTOR
14	9606.ENSP00000483814	0.940	GATOR complex protein NPRL3
15	9606.ENSP00000456405	0.936	Target of rapamycin complex subunit LST8
16	9606.ENSP00000278671	0.933	Ragulator complex protein LAMTOR1
17	9606.ENSP00000357288	0.927	Ragulator complex protein LAMTOR2
18	9606.ENSP00000262746	0.926	Peroxiredoxin-1
19	9606.ENSP00000343118	0.926	Ragulator complex protein LAMTOR4
20	9606.ENSP00000256644	0.924	Ragulator complex protein LAMTOR5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.971	catalytic activity
GO:0016597	0.921	amino acid binding
GO:0140311	0.759	protein sequestering activity
GO:0016667	0.758	oxidoreductase activity, acting on a sulfur group of donors
GO:0016684	0.749	oxidoreductase activity, acting on peroxide as acceptor
GO:0016209	0.743	antioxidant activity
GO:0004601	0.725	peroxidase activity
GO:0070728	0.719	leucine binding
GO:0044877	0.712	protein-containing complex binding
GO:0032542	0.408	sulfiredoxin activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.987	cellular response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0048583	0.984	regulation of response to stimulus
GO:0007154	0.979	cell communication
GO:0033554	0.976	cellular response to stress
GO:0031323	0.958	regulation of cellular metabolic process
GO:0071230	0.957	cellular response to amino acid stimulus
GO:0048518	0.951	positive regulation of biological process
GO:0008152	0.926	metabolic process
GO:1903432	0.919	regulation of TORC1 signaling
GO:0044237	0.918	cellular metabolic process
GO:0009267	0.917	cellular response to starvation
GO:1904262	0.914	negative regulation of TORC1 signaling
GO:0048522	0.903	positive regulation of cellular process
GO:0080090	0.890	regulation of primary metabolic process
GO:0051171	0.883	regulation of nitrogen compound metabolic process
GO:0060255	0.872	regulation of macromolecule metabolic process
GO:0007165	0.865	signal transduction
GO:1990928	0.864	response to amino acid starvation
GO:0009889	0.860	regulation of biosynthetic process
GO:0034198	0.850	cellular response to amino acid starvation
GO:0010506	0.843	regulation of autophagy
GO:0051246	0.830	regulation of protein metabolic process
GO:0035556	0.788	intracellular signal transduction
GO:0010468	0.784	regulation of gene expression
GO:0009893	0.778	positive regulation of metabolic process
GO:0042325	0.766	regulation of phosphorylation
GO:0042149	0.756	cellular response to glucose starvation
GO:0009892	0.740	negative regulation of metabolic process
GO:0031325	0.732	positive regulation of cellular metabolic process
GO:0010508	0.718	positive regulation of autophagy
GO:0031324	0.716	negative regulation of cellular metabolic process
GO:0031326	0.715	regulation of cellular biosynthetic process
GO:0031399	0.711	regulation of protein modification process
GO:0010556	0.655	regulation of macromolecule biosynthetic process
GO:0071704	0.627	organic substance metabolic process
GO:0072593	0.605	reactive oxygen species metabolic process
GO:0010605	0.589	negative regulation of macromolecule metabolic process
GO:0051172	0.587	negative regulation of nitrogen compound metabolic process
GO:0051248	0.578	negative regulation of protein metabolic process
GO:0098869	0.505	cellular oxidant detoxification
GO:0044238	0.503	primary metabolic process
GO:0043555	0.456	regulation of translation in response to stress
GO:0009890	0.413	negative regulation of biosynthetic process
GO:0010629	0.404	negative regulation of gene expression
GO:0010558	0.397	negative regulation of macromolecule biosynthetic process
GO:0031327	0.395	negative regulation of cellular biosynthetic process
GO:0051179	0.354	localization
GO:0030308	0.349	negative regulation of cell growth
GO:0006807	0.330	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.998	cytosol
GO:1902494	0.979	catalytic complex
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0005634	0.940	nucleus
GO:0140535	0.911	intracellular protein-containing complex
GO:0070013	0.868	intracellular organelle lumen
GO:0031981	0.843	nuclear lumen
GO:1990234	0.833	transferase complex
GO:0016020	0.817	membrane
GO:0005654	0.771	nucleoplasm
GO:0061695	0.760	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.753	protein kinase complex
GO:1902554	0.511	serine/threonine protein kinase complex
GO:0043232	0.486	intracellular non-membrane-bounded organelle
GO:1990316	0.463	Atg1/ULK1 kinase complex
GO:0071944	0.340	cell periphery
GO:0005886	0.330	plasma membrane
GO:0031588	0.316	nucleotide-activated protein kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	0.758	Acting on a sulfur group of donors.
EC:1.11.-.-	0.749	Acting on a peroxide as acceptor.
EC:1.11.1.-	0.725	Peroxidases.
RHEA:17545	0.408	[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin]
EC:1.8.98.2	0.408	sulfiredoxin.

[back to server]