StarFunc result for job id P58012

User Input

>input (376 residues)
MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYV
ALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGG
GERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAG
AGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPG
AAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHPHPHAHHLH
AAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQPELAMMHCSY
WDHDSKTGALHSRLDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8MIP2	0.531	0.530	9.632E-54	377	0.976	0.973	Q8MIP2.pdb.gz	FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus OX=9925 GN=FOXL2 PE=1 SV=1
2	AFDB:Q9UJU5	0.258	0.205	2.218E-17	478	0.354	0.278	Q9UJU5.pdb.gz	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
3	AFDB:E0XEN6	0.263	0.262	3.444E-17	378	0.279	0.278	E0XEN6.pdb.gz	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
4	AFDB:Q8R2I0	0.253	0.256	1.137E-16	371	0.332	0.337	Q8R2I0.pdb.gz	FOXE1_MOUSE Forkhead box protein E1 OS=Mus musculus OX=10090 GN=Foxe1 PE=1 SV=2
5	AFDB:A1L1S5	0.285	0.282	1.289E-16	380	0.274	0.271	A1L1S5.pdb.gz	FOXF1_DANRE Forkhead box protein F1 OS=Danio rerio OX=7955 GN=foxf1 PE=2 SV=1
6	AFDB:Q9W707	0.262	0.264	1.765E-16	372	0.287	0.290	Q9W707.pdb.gz	FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis OX=8355 GN=foxf1-b PE=2 SV=1
7	AFDB:O00358	0.253	0.255	2.002E-16	373	0.324	0.327	O00358.pdb.gz	FOXE1_HUMAN Forkhead box protein E1 OS=Homo sapiens OX=9606 GN=FOXE1 PE=1 SV=3
8	AFDB:Q9QY14	0.245	0.320	3.753E-16	288	0.253	0.330	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
9	AFDB:Q16676	0.270	0.220	1.026E-15	465	0.375	0.303	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
10	AFDB:Q7T2N8	0.257	0.231	1.496E-15	419	0.245	0.220	Q7T2N8.pdb.gz
11	PDB:2hdcA	0.214	0.675	7.531E-9	97	0.160	0.619	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:2nyxB	0.147	0.335	4.724E-2	147	0.024	0.061	2nyxB.pdb.gz
13	PDB:6qpqD	0.157	0.532	8.857E-2	82	0.037	0.171	6qpqD.pdb.gz
14	PDB:6mzlA	0.138	0.112	1.004E-1	472	0.040	0.032	6mzlA.pdb.gz
15	PDB:7k5yU	0.162	0.625	1.004E-1	75	0.045	0.227	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
16	PDB:5h3rA	0.155	0.375	1.070E-1	141	0.029	0.078	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
17	PDB:7tjjI	0.172	0.170	1.375E-1	380	0.024	0.024	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
18	PDB:6iwtA	0.157	0.169	1.559E-1	346	0.029	0.032	6iwtA.pdb.gz
19	PDB:6i6mB	0.149	0.156	1.883E-1	357	0.029	0.031	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
20	PDB:6zmiCE	0.152	0.680	2.135E-1	72	0.019	0.097	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58012	0.0	739	376	1.000	1.000	FOXL2_HUMAN Forkhead box protein L2 OS=Homo sapiens OX=9606 GN=FOXL2 PE=1 SV=1
2	Q53ZD3	0.0	739	376	1.000	1.000	Q53ZD3_HUMAN Forkhead box protein L2 OS=Homo sapiens OX=9606 GN=FOXL2 PE=4 SV=1
3	Q8MIP2	0.0	719	377	0.976	0.973	FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus OX=9925 GN=FOXL2 PE=1 SV=1
4	O88470	1.16e-152	437	375	0.944	0.947	FOXL2_MOUSE Forkhead box protein L2 OS=Mus musculus OX=10090 GN=Foxl2 PE=1 SV=2
5	Q2TVT7	1.16e-152	437	375	0.944	0.947	Q2TVT7_MOUSE Forkhead box protein L2 OS=Mus musculus OX=10090 GN=Foxl2 PE=2 SV=1
6	D4A0S1	5.35e-151	432	374	0.939	0.944	D4A0S1_RAT Forkhead box protein L2 OS=Rattus norvegicus OX=10116 GN=Foxl2 PE=4 SV=1
7	Q1JPV2	1.32e-120	353	306	0.564	0.693	Q1JPV2_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-1 PE=2 SV=1
8	F1QJW8	9.38e-96	289	285	0.524	0.691	F1QJW8_DANRE Forkhead box protein L2 OS=Danio rerio OX=7955 GN=foxl2-like PE=2 SV=2
9	Q64731	3.84e-49	170	336	0.191	0.214	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
10	Q7SY22	3.78e-48	169	363	0.207	0.215	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
11	Q12952	2.69e-47	166	345	0.186	0.203	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
12	Q7ZYQ0	8.82e-42	152	373	0.178	0.180	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
13	E0XEN6	9.41e-42	152	378	0.176	0.175	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
14	Q12951	9.41e-42	152	378	0.176	0.175	FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=1 SV=3
15	Q7T1C0	1.31e-41	152	383	0.176	0.172	FXI3B_DANRE Forkhead box protein I3-B OS=Danio rerio OX=7955 GN=foxi3b PE=2 SV=1
16	A3KNJ3	2.49e-41	150	353	0.170	0.181	FXI3A_DANRE Forkhead box protein I3-A OS=Danio rerio OX=7955 GN=foxi3a PE=2 SV=1
17	Q91905	2.57e-41	150	367	0.168	0.172	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
18	Q804B2	5.81e-41	150	377	0.168	0.167	Q804B2_DANRE Forkhead box protein I2 OS=Danio rerio OX=7955 GN=cb724 PE=2 SV=1
19	Q91904	1.07e-40	149	370	0.165	0.168	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
20	Q9PTK2	3.66e-40	147	365	0.191	0.197	FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis OX=8355 GN=foxe4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	3.4e-34	128.2	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332973	0.964	Mothers against decapentaplegic homolog 3
2	9606.ENSP00000348056	0.938	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000221496	0.928	Muellerian-inhibiting factor
4	9606.ENSP00000249636	0.915	E3 SUMO-protein ligase PIAS1
5	9606.ENSP00000245479	0.892	Transcription factor SOX-9
6	9606.ENSP00000371711	0.887	Doublesex- and mab-3-related transcription factor 1
7	9606.ENSP00000348944	0.878	R-spondin-1
8	9606.ENSP00000379683	0.870	Aromatase
9	9606.ENSP00000341551	0.869	Mothers against decapentaplegic homolog 4
10	9606.ENSP00000358716	0.846	Probable ATP-dependent RNA helicase DDX20
11	9606.ENSP00000290167	0.842	Protein Wnt-4
12	9606.ENSP00000376077	0.818	Small ubiquitin-related modifier 1
13	9606.ENSP00000362690	0.808	Steroidogenic factor 1
14	9606.ENSP00000368253	0.795	Nuclear receptor subfamily 0 group B member 1
15	9606.ENSP00000418008	0.764	Mitochondrial ribosomal protein S22
16	9606.ENSP00000419457	0.760	Homeobox protein NOBOX
17	9606.ENSP00000367942	0.756	Growth/differentiation factor 9
18	9606.ENSP00000414657	0.750	Protein odd-skipped-related 2
19	9606.ENSP00000293894	0.744	Transcription factor SOX-8
20	9606.ENSP00000262160	0.740	Mothers against decapentaplegic homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.999	sequence-specific DNA binding
GO:1990837	0.987	sequence-specific double-stranded DNA binding
GO:0005515	0.971	protein binding
GO:0000976	0.861	transcription cis-regulatory region binding
GO:0000981	0.807	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0032502	0.986	developmental process
GO:0032501	0.983	multicellular organismal process
GO:0048856	0.978	anatomical structure development
GO:0031326	0.977	regulation of cellular biosynthetic process
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0010468	0.939	regulation of gene expression
GO:0007275	0.930	multicellular organism development
GO:0009987	0.928	cellular process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0010556	0.907	regulation of macromolecule biosynthetic process
GO:0048518	0.902	positive regulation of biological process
GO:1903506	0.900	regulation of nucleic acid-templated transcription
GO:0006355	0.887	regulation of DNA-templated transcription
GO:0048731	0.863	system development
GO:0048513	0.861	animal organ development
GO:0045137	0.860	development of primary sexual characteristics
GO:0008406	0.834	gonad development
GO:0048522	0.814	positive regulation of cellular process
GO:0048519	0.613	negative regulation of biological process
GO:0050896	0.594	response to stimulus
GO:0009893	0.548	positive regulation of metabolic process
GO:0010604	0.539	positive regulation of macromolecule metabolic process
GO:0046660	0.537	female sex differentiation
GO:0051173	0.531	positive regulation of nitrogen compound metabolic process
GO:0031325	0.504	positive regulation of cellular metabolic process
GO:0048523	0.417	negative regulation of cellular process
GO:0009891	0.413	positive regulation of biosynthetic process
GO:0006357	0.407	regulation of transcription by RNA polymerase II
GO:0009892	0.405	negative regulation of metabolic process
GO:0045935	0.405	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.403	positive regulation of macromolecule biosynthetic process
GO:0010605	0.401	negative regulation of macromolecule metabolic process
GO:0031328	0.401	positive regulation of cellular biosynthetic process
GO:0046545	0.360	development of primary female sexual characteristics
GO:0045893	0.354	positive regulation of DNA-templated transcription
GO:0008152	0.344	metabolic process
GO:0071704	0.321	organic substance metabolic process
GO:0008585	0.311	female gonad development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]