StarFunc result for job id P58107

User Input

>input (1400 residues)
MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAA
MEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATT
GYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLL
DRETWHKLSELEPGTGDLRFLDPNTLERLTYHQLLERCVRAPGSGLALLPLKITFRSMGG
AVSAAELLEVGILDEQAVQGLREGRLAAVDVSARAEVRRYLEGTGSVAGVVLLPEGHKKS
FFQAATEHLLPMGTALPLLEAQAATHTLVDPITGQRLWVDEAVRAGLVSPELHEQLLVAE
QAVTGHHDPFSGSQIPLFQAMKKGLVDRPLALRLLDAQLATGGLVCPARRLRLPLEAALR
CGCLDEDTQRQLSQAGSFSDGTHGGLRYEQLLALCVTDPETGLAFLPLSGGPRGGEPQGP
PFIKYSTRQALSTATATVSVGKFRGRPVSLWELLFSEAISSEQRAMLAQQYQEGTLSVEK
LAAKLSATLEQAAATARVTFSGLRDTVTPGELLKAEIIDQDLYERLEHGQATAKDVGSLA
SVQRYLQGTGCIAGLLLPGSQERLSIYEARCKGLLRPGTALILLEAQAATGFIIDPKANK
GHSVEEALRAAVIGPDVFAKLLSAERAVTGYTDPYTGQQISLFQAMQKGLIVREHGIRLL
EAQIATGGVIDPVHSHRVPVDVAYRRGYFDQMLNLILLDPSDDTKGFFDPNTHENLTYLQ
LLERCVRDPETGLYLLPLSSTQSPLVDSATQQAFQNLLLSVKYGRFQGQRVSAWELINSE
YFSEGRRRQLLRRYRQREVTLGQVAKLLEAETQRQADIMLPALRSRVTVHQLLEAGIIDQ
QLLDQVLAGTISPEALLLMDGVRRYLCGLGAVGGVRLLPSGQRLSLYQAMRQKLLGPRVA
LALLEAQAATGTIMDPHSPESLSVDEAVRRGVVGPELYGRLKRAEGAIAGFRDPFSGKQV
SVFQAMKKGLIPWEQAARLLEAQVATGGIIDPTSHHHLPMPVAIQRGYVDQEMETALSSS
SETFPTPDGQGRTSYAQLLEECPRDETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKD
GTSLWDLLSSCHFTEEQRRGLLEDVQEGRTTVPQLLASVQRWVQETKLLAQARVMVPGPR
GEVPAVWLLDAGIITQETLEALAQGTQSPAQVAEQPAVKACLWGTGCVAGVLLQPSGAKA
SIAQAVRDGLLPTGLGQRLLEAQVASGFLVDPLNNQRLSVEDAVKVGLVGRELSEQLGQA
ERAAAGYPDPYSRASLSLWQAMEKGLVPQNEGLPLLQVQLATGGVVDPVHGVHLPQAAAC
RLGLLDTQTSQVLTAVDKDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D952	0.136	0.095	1.044E-12	2035	0.088	0.060	Q9D952.pdb.gz	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
2	AFDB:Q92817	0.134	0.093	5.496E-11	2033	0.050	0.034	Q92817.pdb.gz	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
3	PDB:5gm6G	0.071	0.096	3.233E-1	875	0.064	0.102	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
4	PDB:3eqlD	0.055	0.057	4.292E-1	1321	0.078	0.083	3eqlD.pdb.gz	Transcription inactivation through local refolding of the RNA polymerase structure.
5	PDB:5uwuC	0.056	0.069	4.717E-1	998	0.066	0.092	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
6	PDB:7ktsA	0.076	0.053	6.880E-1	3042	0.114	0.053	7ktsA.pdb.gz
7	PDB:4kn4X	0.047	0.087	9.132E-1	517	0.055	0.149	4kn4X.pdb.gz	X-ray Crystal Structures of the Escherichia coli RNA Polymerase in Complex with Benzoxazinorifamycins.
8	PDB:6slmA	0.037	0.065	9.132E-1	539	0.028	0.072	6slmA.pdb.gz	Structure of High-Risk Papillomavirus 31 E6 Oncogenic Protein and Characterization of E6/E6AP/p53 Complex Formation.
9	AFDB:Q5U4E2	0.048	0.084	1.019	545	0.063	0.161	Q5U4E2.pdb.gz	REPI1_MOUSE Replication initiator 1 OS=Mus musculus OX=10090 GN=Repin1 PE=1 SV=1
10	PDB:6n1zA	0.054	0.073	1.156	961	0.070	0.102	6n1zA.pdb.gz
11	PDB:7mqaLM	0.069	0.052	1.156	2041	0.109	0.075	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:4egcA	0.046	0.090	1.271	539	0.051	0.132	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7ni5A	0.064	0.043	1.332	2791	0.109	0.055	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
14	AFDB:Q20937	0.059	0.038	1.882	2641	0.063	0.033	Q20937.pdb.gz	CNOT1_CAEEL CCR4-NOT transcription complex subunit let-711 OS=Caenorhabditis elegans OX=6239 GN=let-711 PE=1 SV=3
15	AFDB:P70398	0.067	0.045	2.168	2559	0.137	0.075	P70398.pdb.gz	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
16	AFDB:Q583E1	0.056	0.066	2.272	1080	0.064	0.082	Q583E1.pdb.gz	Q583E1_TRYB2 RNA polymerase II-associated protein 1 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.580 PE=4 SV=1
17	AFDB:Q9NUA8	0.052	0.056	2.382	1239	0.056	0.063	Q9NUA8.pdb.gz	ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4
18	AFDB:A2BG45	0.050	0.077	6.418	750	0.035	0.065	A2BG45.pdb.gz	A2BG45_DANRE ARF GTPase-activating protein GIT2 OS=Danio rerio OX=7955 GN=git2 PE=4 SV=1
19	AFDB:P25851	0.025	0.052	7.394	417	0.016	0.055	P25851.pdb.gz	F16P1_ARATH Fructose-1,6-bisphosphatase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CFBP1 PE=1 SV=2
20	AFDB:Q12060	0.031	0.068	8.126	488	0.038	0.109	Q12060.pdb.gz	HFI1_YEAST Transcriptional coactivator HFI1/ADA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFI1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A075B730	0.0	2747	5063	0.982	0.272	A0A075B730_HUMAN Epiplakin 1 OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=2
2	A0A0R4IJ71	0.0	617	4506	0.280	0.087	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
3	A0A286YBE9	0.0	749	4773	0.361	0.106	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
4	A0A2R8PVX9	0.0	749	4580	0.361	0.110	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
5	A0A2R8RIJ1	0.0	749	4599	0.361	0.110	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
6	A5WV02	0.0	749	4577	0.362	0.111	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
7	E7F8G7	0.0	749	4762	0.361	0.106	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
8	E9QCV2	0.0	618	4530	0.280	0.087	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
9	H0YDN1	0.0	768	3447	0.300	0.122	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
10	P30427	0.0	861	4687	0.404	0.121	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
11	P58107	0.0	2798	5088	1.000	0.275	EPIPL_HUMAN Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3
12	Q15149	0.0	818	4684	0.368	0.110	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
13	Q8R0W0	0.0	2019	6548	0.756	0.162	EPIPL_MOUSE Epiplakin OS=Mus musculus OX=10090 GN=Eppk1 PE=1 SV=2
14	Q9JI55	0.0	852	4473	0.407	0.127	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1
15	Q9QXS1	0.0	863	4691	0.414	0.123	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
16	P15924	4.95e-121	421	2871	0.224	0.109	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3
17	F1LMV6	2.77e-116	407	2877	0.222	0.108	DESP_RAT Desmoplakin OS=Rattus norvegicus OX=10116 GN=Dsp PE=1 SV=1
18	E9Q557	3.07e-116	407	2883	0.224	0.109	DESP_MOUSE Desmoplakin OS=Mus musculus OX=10090 GN=Dsp PE=1 SV=1
19	Q9QXZ0	7.33e-30	132	7354	0.079	0.015	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2
20	Q9UPN3	1.61e-29	131	7388	0.081	0.015	MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00681 Plectin	1.3e-183	605.9	Plectin repeat
2	PF14449 PT-TG	1.5e+02	13.8	Pre-toxin TG

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484472

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340510	0.758	Periplakin
2	9606.ENSP00000361311	0.723	Transmembrane protein 53
3	9606.ENSP00000414055	0.703	Nuclear receptor-binding protein 2
4	9606.ENSP00000299698	0.683	Alpha-2-macroglobulin-like protein 1
5	9606.ENSP00000347548	0.675	E3 ubiquitin-protein ligase RNF220
6	9606.ENSP00000434359	0.673	Poly(U)-binding-splicing factor PUF60
7	9606.ENSP00000307959	0.670	Dystonin
8	9606.ENSP00000377471	0.662	Coronin-1B
9	9606.ENSP00000229390	0.653	Serine/arginine-rich splicing factor 9
10	9606.ENSP00000257189	0.633	Desmoglein-3
11	9606.ENSP00000440374	0.626	Guanine nucleotide exchange factor DBS
12	9606.ENSP00000331678	0.611	Plakophilin-3
13	9606.ENSP00000362207	0.595	Carbohydrate sulfotransferase 3
14	9606.ENSP00000278886	0.590	Ninein-like protein
15	9606.ENSP00000257192	0.572	Desmoglein-1
16	9606.ENSP00000354573	0.543	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
17	9606.ENSP00000263946	0.532	Plakophilin-1
18	9606.ENSP00000257198	0.522	Desmocollin-1
19	9606.ENSP00000449404	0.521	Keratin, type II cytoskeletal 8
20	9606.ENSP00000357791	0.517	Hornerin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0003723	0.992	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042127	0.987	regulation of cell population proliferation
GO:0045109	0.986	intermediate filament organization
GO:0040013	0.985	negative regulation of locomotion
GO:0050678	0.983	regulation of epithelial cell proliferation
GO:2000145	0.980	regulation of cell motility
GO:0048583	0.964	regulation of response to stimulus
GO:2000146	0.949	negative regulation of cell motility
GO:0032102	0.941	negative regulation of response to external stimulus
GO:0030336	0.941	negative regulation of cell migration
GO:0050680	0.927	negative regulation of epithelial cell proliferation
GO:1903035	0.844	negative regulation of response to wounding
GO:0061041	0.599	regulation of wound healing
GO:0061045	0.570	negative regulation of wound healing
GO:0042060	0.568	wound healing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0045111	0.985	intermediate filament cytoskeleton
GO:0071944	0.925	cell periphery
GO:0005886	0.866	plasma membrane
GO:0005737	0.593	cytoplasm
GO:0005911	0.583	cell-cell junction
GO:0043227	0.447	membrane-bounded organelle
GO:0099080	0.435	supramolecular complex
GO:0099513	0.415	polymeric cytoskeletal fiber
GO:0005654	0.321	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]