StarFunc result for job id P58166

User Input

>input (350 residues)
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSR
PRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHH
LYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRG
EKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTC
EPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58166	1.000	1.000	6.884E-70	350	1.000	1.000	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
2	AFDB:P55103	0.469	0.466	7.795E-34	352	0.414	0.412	P55103.pdb.gz	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
3	AFDB:Q91350	0.406	0.386	6.828E-27	370	0.320	0.303	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
4	AFDB:A4D1W7	0.439	0.366	2.018E-26	426	0.329	0.270	A4D1W7.pdb.gz	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
5	AFDB:P17491	0.417	0.360	9.203E-26	411	0.343	0.292	P17491.pdb.gz	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
6	AFDB:P27093	0.415	0.377	2.312E-25	391	0.340	0.304	P27093.pdb.gz	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
7	AFDB:Q8QGE3	0.447	0.399	6.303E-24	395	0.329	0.291	Q8QGE3.pdb.gz	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
8	AFDB:Q9VQG9	0.402	0.248	1.085E-21	586	0.220	0.131	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
9	AFDB:P34820	0.322	0.285	1.209E-21	402	0.283	0.246	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
10	PDB:5hlyA	0.346	0.402	3.147E-21	299	0.263	0.308	5hlyA.pdb.gz
11	AFDB:P34821	0.346	0.308	6.485E-21	399	0.277	0.243	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
12	PDB:5ntuA	0.333	0.375	1.255E-17	308	0.229	0.260	5ntuA.pdb.gz
13	PDB:5nxsA	0.335	0.398	2.541E-15	290	0.229	0.276	5nxsA.pdb.gz
14	PDB:5vqfB	0.290	0.315	3.332E-15	320	0.211	0.231	5vqfB.pdb.gz
15	PDB:3rjrC	0.291	0.297	6.383E-15	343	0.231	0.236	3rjrC.pdb.gz
16	PDB:6umxA	0.266	0.324	3.073E-14	279	0.206	0.258	6umxA.pdb.gz
17	PDB:5ffoG	0.310	0.359	1.939E-13	297	0.217	0.256	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.260	0.291	1.605E-12	308	0.211	0.240	7y1rB.pdb.gz
19	PDB:5nxsB	0.300	0.412	2.913E-12	251	0.197	0.275	5nxsB.pdb.gz
20	PDB:7lvzD	0.113	0.149	1.568E-3	246	0.123	0.175	7lvzD.pdb.gz	The Crystal Structure of Cysteamine Dioxygenase Reveals the Origin of the Large Substrate Scope of This Vital Mammalian Enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58166	0.0	709	350	1.000	1.000	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
2	P55103	2.02e-78	246	352	0.431	0.429	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
3	P09529	4.65e-54	184	407	0.366	0.314	INHBB_HUMAN Inhibin beta B chain OS=Homo sapiens OX=9606 GN=INHBB PE=1 SV=2
4	P27093	2.05e-53	182	391	0.343	0.307	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
5	Q91350	2.67e-52	179	370	0.349	0.330	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
6	P17491	4.29e-52	179	411	0.354	0.302	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
7	Q04999	5.13e-52	179	411	0.354	0.302	INHBB_MOUSE Inhibin beta B chain OS=Mus musculus OX=10090 GN=Inhbb PE=2 SV=4
8	Q04998	1.61e-51	178	424	0.360	0.297	INHBA_MOUSE Inhibin beta A chain OS=Mus musculus OX=10090 GN=Inhba PE=1 SV=1
9	P18331	4.00e-51	177	424	0.357	0.295	INHBA_RAT Inhibin beta A chain OS=Rattus norvegicus OX=10116 GN=Inhba PE=2 SV=1
10	A4D1W7	2.87e-49	172	426	0.371	0.305	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
11	P08476	2.87e-49	172	426	0.371	0.305	INHBA_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=2
12	P07995	1.66e-48	170	425	0.363	0.299	INHBA_BOVIN Inhibin beta A chain OS=Bos taurus OX=9913 GN=INHBA PE=1 SV=2
13	Q8QGE3	3.42e-48	169	395	0.340	0.301	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
14	P35621	1.39e-23	102	355	0.140	0.138	DVR1_DANRE Protein DVR-1 OS=Danio rerio OX=7955 GN=dvr1 PE=2 SV=1
15	H0YI30	1.91e-23	102	380	0.297	0.274	H0YI30_HUMAN Growth differentiation factor 11 (Fragment) OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
16	C8C060	2.35e-23	102	396	0.183	0.162	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
17	P12643	2.35e-23	102	396	0.183	0.162	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
18	Q9Z217	2.93e-23	101	405	0.297	0.257	GDF11_RAT Growth/differentiation factor 11 OS=Rattus norvegicus OX=10116 GN=Gdf11 PE=2 SV=2
19	P49001	3.06e-23	101	393	0.183	0.163	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
20	O95390	3.67e-23	101	407	0.297	0.256	GDF11_HUMAN Growth/differentiation factor 11 OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15777 Anti-TRAP	2.4e+02	13.1	Tryptophan RNA-binding attenuator protein inhibitory protein
2	PF00019 TGF_beta	2.7e-26	103.8	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256759	0.927	Follistatin
2	9606.ENSP00000416606	0.900	Follitropin subunit beta
3	9606.ENSP00000482232	0.900	Glycoprotein hormones, alpha polypeptide
4	9606.ENSP00000241416	0.874	Activin receptor type-2A
5	9606.ENSP00000340361	0.868	Activin receptor type-2B
6	9606.ENSP00000287139	0.818	Nodal homolog
7	9606.ENSP00000238682	0.813	Transforming growth factor beta-3
8	9606.ENSP00000221930	0.810	Transforming growth factor beta-1
9	9606.ENSP00000243349	0.756	Activin receptor type-1C
10	9606.ENSP00000371532	0.728	Very low-density lipoprotein receptor
11	9606.ENSP00000319370	0.682	Calcium-activated potassium channel subunit beta-3
12	9606.ENSP00000243786	0.676	Inhibin alpha chain
13	9606.ENSP00000426548	0.616	BTB/POZ domain-containing protein KCTD16
14	9606.ENSP00000280358	0.602	Testis-expressed protein 12
15	9606.ENSP00000303634	0.573	Low-density lipoprotein receptor-related protein 8
16	9606.ENSP00000361266	0.564	Protein patched homolog 2
17	9606.ENSP00000265107	0.538	WD repeat-containing protein 70
18	9606.ENSP00000371267	0.538	14-3-3 protein theta
19	9606.ENSP00000405812	0.509	Electroneutral sodium bicarbonate exchanger 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0030546	0.898	signaling receptor activator activity
GO:0048018	0.891	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0050794	0.991	regulation of cellular process
GO:0048856	0.990	anatomical structure development
GO:0050896	0.975	response to stimulus
GO:0009987	0.968	cellular process
GO:0048518	0.884	positive regulation of biological process
GO:0007275	0.756	multicellular organism development
GO:0023051	0.746	regulation of signaling
GO:0010646	0.746	regulation of cell communication
GO:0048519	0.699	negative regulation of biological process
GO:0048522	0.683	positive regulation of cellular process
GO:0051716	0.652	cellular response to stimulus
GO:0048523	0.623	negative regulation of cellular process
GO:0048583	0.617	regulation of response to stimulus
GO:0009966	0.541	regulation of signal transduction
GO:0048513	0.475	animal organ development
GO:0060255	0.410	regulation of macromolecule metabolic process
GO:0048731	0.409	system development
GO:0023056	0.401	positive regulation of signaling
GO:0010647	0.401	positive regulation of cell communication
GO:0007154	0.397	cell communication
GO:0080090	0.392	regulation of primary metabolic process
GO:0023052	0.349	signaling
GO:0050793	0.342	regulation of developmental process
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0007165	0.331	signal transduction
GO:0051239	0.330	regulation of multicellular organismal process
GO:0010468	0.320	regulation of gene expression
GO:0007178	0.310	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0031323	0.304	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.996	cell periphery
GO:0005576	0.948	extracellular region
GO:0005886	0.861	plasma membrane
GO:0030312	0.791	external encapsulating structure
GO:0031012	0.775	extracellular matrix
GO:0005622	0.765	intracellular anatomical structure
GO:0062023	0.747	collagen-containing extracellular matrix
GO:0005737	0.723	cytoplasm
GO:0032991	0.680	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]