StarFunc result for job id P58215

User Input

>input (753 residues)
MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTGPEKKAGSQGLRFRLAGFPRKPYEGRVEI
QRAGEWGTICDDDFTLQAAHILCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQS
VTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHS
FGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGGPAVVSCVPGPVYAASSGQKKQQQSK
PQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGA
RMGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS
GGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSG
NITEVVMSGVRCTGTELSLDQCAHHGTHITCKRTGTRFTAGVICSETASDLLLHSALVQE
TAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQ
GITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGH
RIWVHNCHIGDAFSEEANRRFERYPGQTSNQII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DF27	0.791	0.769	0.000	776	0.550	0.534	B5DF27.pdb.gz	LOXL2_RAT Lysyl oxidase homolog 2 OS=Rattus norvegicus OX=10116 GN=Loxl2 PE=2 SV=2
2	AFDB:B8A4W9	0.773	0.726	0.000	807	0.683	0.637	B8A4W9.pdb.gz	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
3	AFDB:F1QQC3	0.788	0.804	0.000	737	0.546	0.558	F1QQC3.pdb.gz	LOL2A_DANRE Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1
4	AFDB:Q924C6	0.784	0.780	0.000	757	0.551	0.548	Q924C6.pdb.gz	LOXL4_MOUSE Lysyl oxidase homolog 4 OS=Mus musculus OX=10090 GN=Loxl4 PE=2 SV=2
5	AFDB:Q96JB6	0.824	0.821	0.000	756	0.550	0.548	Q96JB6.pdb.gz	LOXL4_HUMAN Lysyl oxidase homolog 4 OS=Homo sapiens OX=9606 GN=LOXL4 PE=1 SV=1
6	AFDB:Q9Z175	0.814	0.813	0.000	754	0.928	0.927	Q9Z175.pdb.gz	LOXL3_MOUSE Lysyl oxidase homolog 3 OS=Mus musculus OX=10090 GN=Loxl3 PE=1 SV=2
7	AFDB:Q9Y4K0	0.786	0.767	1.836E-102	774	0.552	0.537	Q9Y4K0.pdb.gz	LOXL2_HUMAN Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1
8	AFDB:Q9UGM3	0.142	0.065	1.040E-38	2413	0.267	0.083	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
9	AFDB:Q60997	0.146	0.054	1.907E-36	2085	0.243	0.088	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
10	AFDB:Q9V9X5	0.385	0.775	3.039E-35	360	0.175	0.367	Q9V9X5.pdb.gz	Q9V9X5_DROME Lysyl oxidase-like OS=Drosophila melanogaster OX=7227 GN=Loxl1 PE=2 SV=1
11	PDB:2xrcC	0.105	0.171	1.714E-3	454	0.035	0.057	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
12	PDB:2xrcB	0.118	0.177	6.659E-3	485	0.032	0.049	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
13	PDB:6drvA	0.099	0.077	1.061E-1	1024	0.028	0.021	6drvA.pdb.gz
14	PDB:7tysA	0.063	0.105	1.249E-1	361	0.021	0.044	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
15	PDB:3lpfA	0.079	0.092	1.929E-1	603	0.028	0.035	3lpfA.pdb.gz	Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
16	PDB:3jcmN	0.095	0.047	2.396E-1	1686	0.021	0.009	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
17	PDB:7mjpA	0.063	0.105	2.530E-1	366	0.023	0.046	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
18	PDB:7zdzA	0.089	0.160	3.504E-1	325	0.028	0.065	7zdzA.pdb.gz
19	PDB:6fonA	0.053	0.108	3.700E-1	252	0.036	0.107	6fonA.pdb.gz	Molecular recognition and maturation of SOD1 by its evolutionarily destabilised cognate chaperone hCCS.
20	PDB:5a42A	0.044	0.025	4.124E-1	1597	0.042	0.020	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DF27	0.0	875	776	0.547	0.531	LOXL2_RAT Lysyl oxidase homolog 2 OS=Rattus norvegicus OX=10116 GN=Loxl2 PE=2 SV=2
2	B8A4W9	0.0	1089	807	0.695	0.648	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
3	F1QQC3	0.0	852	737	0.556	0.569	LOL2A_DANRE Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1
4	P58022	0.0	874	776	0.546	0.530	LOXL2_MOUSE Lysyl oxidase homolog 2 OS=Mus musculus OX=10090 GN=Loxl2 PE=1 SV=2
5	P58215	0.0	1558	753	1.000	1.000	LOXL3_HUMAN Lysyl oxidase homolog 3 OS=Homo sapiens OX=9606 GN=LOXL3 PE=1 SV=1
6	Q924C6	0.0	823	757	0.544	0.542	LOXL4_MOUSE Lysyl oxidase homolog 4 OS=Mus musculus OX=10090 GN=Loxl4 PE=2 SV=2
7	Q96JB6	0.0	834	756	0.547	0.545	LOXL4_HUMAN Lysyl oxidase homolog 4 OS=Homo sapiens OX=9606 GN=LOXL4 PE=1 SV=1
8	Q9Y4K0	0.0	886	774	0.551	0.536	LOXL2_HUMAN Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1
9	Q9Z175	0.0	1449	754	0.928	0.927	LOXL3_MOUSE Lysyl oxidase homolog 3 OS=Mus musculus OX=10090 GN=Loxl3 PE=1 SV=2
10	Q6NYT8	2.44e-67	230	408	0.142	0.262	Q6NYT8_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=zgc:77447 PE=2 SV=1
11	Q9V9X5	9.55e-66	224	360	0.174	0.364	Q9V9X5_DROME Lysyl oxidase-like OS=Drosophila melanogaster OX=7227 GN=Loxl1 PE=2 SV=1
12	P28301	1.06e-65	226	411	0.141	0.258	LYOX_MOUSE Protein-lysine 6-oxidase OS=Mus musculus OX=10090 GN=Lox PE=1 SV=1
13	P28300	1.39e-65	225	417	0.141	0.254	LYOX_HUMAN Protein-lysine 6-oxidase OS=Homo sapiens OX=9606 GN=LOX PE=1 SV=2
14	Q9UGM3	5.64e-65	238	2413	0.242	0.075	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
15	Q60997	3.32e-64	235	2085	0.226	0.082	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
16	P16636	3.80e-64	221	411	0.138	0.253	LYOX_RAT Protein-lysine 6-oxidase OS=Rattus norvegicus OX=10116 GN=Lox PE=1 SV=2
17	A6MH35	1.70e-63	221	444	0.149	0.252	A6MH35_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=loxl5b PE=2 SV=1
18	Q08397	4.72e-63	223	574	0.145	0.190	LOXL1_HUMAN Lysyl oxidase homolog 1 OS=Homo sapiens OX=9606 GN=LOXL1 PE=1 SV=2
19	P97873	6.98e-63	223	607	0.145	0.180	LOXL1_MOUSE Lysyl oxidase homolog 1 OS=Mus musculus OX=10090 GN=Loxl1 PE=2 SV=3
20	F1QGY9	7.45e-63	219	445	0.147	0.249	F1QGY9_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=loxl5b PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07705 CARDB	1.2e+02	14.4	CARDB
2	PF09272 Hepsin-SRCR	0.0059	28.6	Hepsin, SRCR domain
3	PF01186 Lysyl_oxidase	3.1e-98	338.9	Lysyl oxidase
4	PF00530 SRCR	2.9e-92	314.9	Scavenger receptor cysteine-rich domain
5	PF15494 SRCR_2	1.2e-14	66.1	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264094

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351807	0.962	Elastin
2	9606.ENSP00000305714	0.956	Bone morphogenetic protein 1
3	9606.ENSP00000373783	0.940	Lysyl oxidase homolog 2
4	9606.ENSP00000260702	0.935	Lysyl oxidase homolog 4
5	9606.ENSP00000345008	0.931	Fibulin-5
6	9606.ENSP00000261921	0.927	Lysyl oxidase homolog 1
7	9606.ENSP00000231004	0.917	Protein-lysine 6-oxidase
8	9606.ENSP00000223061	0.909	Procollagen C-endopeptidase enhancer 1
9	9606.ENSP00000352455	0.904	Microfibrillar-associated protein 5
10	9606.ENSP00000061240	0.903	Tolloid-like protein 1
11	9606.ENSP00000364685	0.902	Microfibrillar-associated protein 2
12	9606.ENSP00000350630	0.901	Tolloid-like protein 2
13	9606.ENSP00000244050	0.692	Zinc finger protein SNAI1
14	9606.ENSP00000258080	0.637	Serine protease HTRA2, mitochondrial
15	9606.ENSP00000361834	0.625	Collagen alpha-2(IX) chain
16	9606.ENSP00000269216	0.574	Transcription factor GATA-6
17	9606.ENSP00000346839	0.562	Fibronectin type III domain containing
18	9606.ENSP00000359114	0.535	Collagen alpha-1(XI) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.999	catalytic activity, acting on a protein
GO:0005515	0.999	protein binding
GO:0016641	0.999	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
GO:0004720	0.762	protein-lysine 6-oxidase activity
GO:0046872	0.583	metal ion binding
GO:0005507	0.395	copper ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0007275	0.988	multicellular organism development
GO:0009987	0.984	cellular process
GO:0050789	0.980	regulation of biological process
GO:0071704	0.950	organic substance metabolic process
GO:0048513	0.944	animal organ development
GO:1901564	0.937	organonitrogen compound metabolic process
GO:0044238	0.928	primary metabolic process
GO:0050794	0.909	regulation of cellular process
GO:0019538	0.907	protein metabolic process
GO:0048519	0.893	negative regulation of biological process
GO:0018205	0.890	peptidyl-lysine modification
GO:0060485	0.887	mesenchyme development
GO:0048731	0.857	system development
GO:0019222	0.837	regulation of metabolic process
GO:0048523	0.828	negative regulation of cellular process
GO:0010556	0.816	regulation of macromolecule biosynthetic process
GO:0031326	0.807	regulation of cellular biosynthetic process
GO:0080090	0.731	regulation of primary metabolic process
GO:0051171	0.730	regulation of nitrogen compound metabolic process
GO:0010468	0.696	regulation of gene expression
GO:0010605	0.690	negative regulation of macromolecule metabolic process
GO:0001837	0.677	epithelial to mesenchymal transition
GO:0051239	0.633	regulation of multicellular organismal process
GO:0009653	0.607	anatomical structure morphogenesis
GO:0050793	0.596	regulation of developmental process
GO:0071840	0.574	cellular component organization or biogenesis
GO:0050896	0.538	response to stimulus
GO:0016043	0.527	cellular component organization
GO:0045595	0.514	regulation of cell differentiation
GO:0019219	0.507	regulation of nucleobase-containing compound metabolic process
GO:0097435	0.447	supramolecular fiber organization
GO:0048518	0.351	positive regulation of biological process
GO:2000026	0.326	regulation of multicellular organismal development
GO:2001141	0.316	regulation of RNA biosynthetic process
GO:0051093	0.311	negative regulation of developmental process
GO:0006355	0.306	regulation of DNA-templated transcription
GO:1902679	0.302	negative regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.990	membrane-bounded organelle
GO:0005622	0.957	intracellular anatomical structure
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0005737	0.923	cytoplasm
GO:0005615	0.867	extracellular space
GO:0005634	0.752	nucleus
GO:1903561	0.419	extracellular vesicle
GO:0070062	0.412	extracellular exosome
GO:0071944	0.411	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.3.-	0.999	With oxygen as acceptor.
RHEA:24544	0.762	H2O + L-lysyl-[protein] + O2 = (S)-2-amino-6-oxohexanoyl-[protein] + H2O2 + NH4(+)
EC:1.4.3.13	0.762	protein-lysine 6-oxidase.

[back to server]