StarFunc result for job id P58340

User Input

>input (268 residues)
MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDG
EDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEP
PKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEV
NQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQS
PAIEHGRRSNVLGDKLHIKGSSVKSNKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58340	1.000	1.000	3.749E-46	268	1.000	1.000	P58340.pdb.gz	MLF1_HUMAN Myeloid leukemia factor 1 OS=Homo sapiens OX=9606 GN=MLF1 PE=1 SV=1
2	AFDB:Q9QWV4	0.720	0.723	1.270E-34	267	0.799	0.801	Q9QWV4.pdb.gz	MLF1_MOUSE Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1
3	AFDB:Q15773	0.464	0.499	1.719E-17	248	0.340	0.367	Q15773.pdb.gz	MLF2_HUMAN Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1
4	AFDB:Q9NKV0	0.411	0.298	3.557E-14	376	0.265	0.189	Q9NKV0.pdb.gz	MLF_DROME Myeloid leukemia factor OS=Drosophila melanogaster OX=7227 GN=Mlf PE=1 SV=2
5	AFDB:Q9H0X4	0.134	0.072	1.519E-2	552	0.067	0.033	Q9H0X4.pdb.gz	F234A_HUMAN Protein FAM234A OS=Homo sapiens OX=9606 GN=FAM234A PE=1 SV=1
6	AFDB:P27780	0.150	0.184	2.556E-2	188	0.101	0.144	P27780.pdb.gz	CUP8_DROME Pupal cuticle protein Edg-84A OS=Drosophila melanogaster OX=7227 GN=Edg84A PE=2 SV=1
7	AFDB:I1MBG9	0.096	0.080	2.708E-2	332	0.078	0.063	I1MBG9.pdb.gz	I1MBG9_SOYBN WRKY domain-containing protein OS=Glycine max OX=3847 GN=GLYMA_14G199800 PE=4 SV=1
8	AFDB:E7ENX8	0.103	0.042	2.869E-2	843	0.086	0.027	E7ENX8.pdb.gz	E7ENX8_HUMAN ABC-type antigen peptide transporter (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
9	AFDB:P11171	0.162	0.068	2.869E-2	864	0.108	0.034	P11171.pdb.gz	EPB41_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4
10	AFDB:Q0II00	0.114	0.044	3.221E-2	902	0.134	0.040	Q0II00.pdb.gz	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
11	PDB:6xywBd	0.119	0.144	5.580E-2	216	0.093	0.116	6xywBd.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
12	PDB:4pn1B	0.130	0.133	7.452E-2	261	0.052	0.054	4pn1B.pdb.gz	Fission yeast RNA triphosphatase reads an Spt5 CTD code.
13	PDB:4akrB	0.123	0.131	7.895E-2	245	0.056	0.061	4akrB.pdb.gz
14	PDB:1iznA	0.118	0.116	1.581E-1	275	0.063	0.062	1iznA.pdb.gz
15	PDB:4runB	0.134	0.210	1.675E-1	152	0.049	0.086	4runB.pdb.gz
16	PDB:2qosC	0.114	0.163	1.880E-1	173	0.045	0.069	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
17	PDB:7dmeA	0.128	0.115	1.880E-1	308	0.093	0.081	7dmeA.pdb.gz
18	PDB:5lj5t	0.103	0.065	2.369E-1	438	0.052	0.032	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
19	PDB:7krwA	0.090	0.046	2.369E-1	608	0.071	0.031	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
20	PDB:3cm1A	0.129	0.197	2.510E-1	137	0.041	0.080	3cm1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58340	0.0	556	268	1.000	1.000	MLF1_HUMAN Myeloid leukemia factor 1 OS=Homo sapiens OX=9606 GN=MLF1 PE=1 SV=1
2	Q9QWV4	1.10e-158	443	267	0.806	0.809	MLF1_MOUSE Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1
3	Q15773	6.32e-45	153	248	0.354	0.383	MLF2_HUMAN Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1
4	Q99KX1	7.15e-45	153	247	0.354	0.385	MLF2_MOUSE Myeloid leukemia factor 2 OS=Mus musculus OX=10090 GN=Mlf2 PE=1 SV=1
5	Q9NKV0	1.01e-28	114	376	0.209	0.149	MLF_DROME Myeloid leukemia factor OS=Drosophila melanogaster OX=7227 GN=Mlf PE=1 SV=2
6	Q9WV19	0.33	34.7	494	0.049	0.026	Q9WV19_MOUSE Cytochrome P450 OS=Mus musculus OX=10090 GN=Cyp2g1 PE=1 SV=1
7	O65621	0.46	34.3	363	0.056	0.041	CADH6_ARATH Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana OX=3702 GN=CAD6 PE=2 SV=1
8	P10610	1.3	32.7	494	0.049	0.026	CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus OX=10116 GN=Cyp2g1 PE=2 SV=1
9	Q9V5N8	4.2	31.6	3579	0.067	0.005	STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4
10	A7XY94	8.3	30.4	1448	0.052	0.010	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10248 Mlf1IP	8e-74	258.9	Myelodysplasia-myeloid leukemia factor 1-interacting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000050980

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000014538	0.973	Pan troglodytes tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), mRNA
2	9598.ENSPTRP00000018825	0.670	Fibrillarin
3	9598.ENSPTRP00000028170	0.666	PR domain containing 5
4	9598.ENSPTRP00000002666	0.592	Dual specificity phosphatase 12
5	9598.ENSPTRP00000028540	0.566	MLF1 interacting protein
6	9598.ENSPTRP00000039228	0.566	Cytochrome b561
7	9598.ENSPTRP00000010610	0.565	E2F-associated phosphoprotein
8	9598.ENSPTRP00000028173	0.557	TNFAIP3 interacting protein 3
9	9598.ENSPTRP00000015076	0.549	Developmentally regulated GTP binding protein 2
10	9598.ENSPTRP00000020216	0.546	Nuclear receptor binding protein 1
11	9598.ENSPTRP00000048819	0.546	ADAM metallopeptidase domain 23
12	9598.ENSPTRP00000009480	0.536	Arginine/serine-rich coiled-coil 2
13	9598.ENSPTRP00000031516	0.531	HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
14	9598.ENSPTRP00000058757	0.506	Uncharacterized protein
15	9598.ENSPTRP00000027482	0.503	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:1901363	0.552	heterocyclic compound binding
GO:0097159	0.550	organic cyclic compound binding
GO:0003676	0.392	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.978	regulation of cellular process
GO:0009987	0.847	cellular process
GO:0048583	0.843	regulation of response to stimulus
GO:0009966	0.817	regulation of signal transduction
GO:0010564	0.808	regulation of cell cycle process
GO:1901796	0.797	regulation of signal transduction by p53 class mediator
GO:1901987	0.742	regulation of cell cycle phase transition
GO:1902806	0.599	regulation of cell cycle G1/S phase transition
GO:0071704	0.387	organic substance metabolic process
GO:0044238	0.387	primary metabolic process
GO:0006807	0.351	nitrogen compound metabolic process
GO:0044237	0.324	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0048471	0.765	perinuclear region of cytoplasm
GO:0043228	0.721	non-membrane-bounded organelle
GO:0043232	0.605	intracellular non-membrane-bounded organelle
GO:0005829	0.578	cytosol
GO:0070013	0.557	intracellular organelle lumen
GO:0031981	0.541	nuclear lumen
GO:0005654	0.516	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]