StarFunc result for job id P58397

User Input

>input (1594 residues)
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRV
DASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIME
KRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVK
KHPLVEGGYHPHIVYRRQKVPETKEPTCGLKDSVNISQKQELWREKWERHNLPSRSLSRR
SISKERWVETLVVADTKMIEYHGSENVESYILTIMNMVTGLFHNPSIGNAIHIVVVRLIL
LEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDICAGFNRPCET
LGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHPYIMS
RQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQL
QYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPES
IPGGWGRWSPWSHCSRTCGAGVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSEA
PTFRQMQCSEFDTVPYKNELYHWFPIFNPAHPCELYCRPIDGQFSEKMLDAVIDGTPCFE
GGNSRNVCINGICKMVGCDYEIDSNATEDRCGVCLGDGSSCQTVRKMFKQKEGSGYVDIG
LIPKGARDIRVMEIEGAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDRKGDL
EKLMATGPTNESVWIQLLFQVTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGHWTECSVTC
GTGIRRQTAHCIKKGRGMVKATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGP
HGEKKRTVLCIQTMVSDEQALPPTDCQHLLKPKTLLSCNRDILCPSDWTVGNWSECSVSC
GGGVRIRSVTCAKNHDEPCDVTRKPNSRALCGLQQCPSSRRVLKPNKGTISNGKNPPTLK
PVPPPTSRPRMLTTPTGPESMSTSTPAISSPSPTTASKEGDLGGKQWQDSSTQPELSSRY
LISTGSTSQPILTSQSLSIQPSEENVSSSDTGPTSEGGLVATTTSGSGLSSSRNPITWPV
TPFYNTLTKGPEMEIHSGSGEEREQPEDKDESNPVIWTKIRVPGNDAPVESTEMPLAPPL
TPDLSRESWWPPFSTVMEGLLPSQRPTTSETGTPRVEGMVTEKPANTLLPLGGDHQPEPS
GKTANRNHLKLPNNMNQTKSSEPVLTEEDATSLITEGFLLNASNYKQLTNGHGSAHWIVG
NWSECSTTCGLGAYWRRVECSTQMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCSRNC
SGGFKIREIQCVDSRDHRNLRPFHCQFLAGIPPPLSMSCNPEPCEAWQVEPWSQCSRSCG
GGVQERGVFCPGGLCDWTKRPTSTMSCNEHLCCHWATGNWDLCSTSCGGGFQKRTVQCVP
SEGNKTEDQDQCLCDHKPRPPEFKKCNQQACKKSADLLCTKDKLSASFCQTLKAMKKCSV
PTVRAECCFSCPQTHITHTQRQRRQRLLQKSKEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58397	1.000	1.000	0.000	1594	1.000	1.000	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
2	AFDB:Q4VC17	0.415	0.528	0.000	1219	0.262	0.343	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
3	AFDB:Q68SA9	0.535	0.516	0.000	1657	0.450	0.433	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
4	AFDB:Q811B3	0.764	0.762	0.000	1600	0.807	0.804	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
5	AFDB:Q8TE60	0.375	0.481	0.000	1221	0.264	0.345	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
6	AFDB:Q9UKP4	0.509	0.484	0.000	1686	0.467	0.441	Q9UKP4.pdb.gz	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
7	AFDB:E7FFX0	0.374	0.473	1.449E-103	1224	0.246	0.320	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
8	AFDB:Q6QU65	0.201	0.222	2.156E-22	1407	0.157	0.178	Q6QU65.pdb.gz	Q6QU65_DROME ADAM metalloprotease OS=Drosophila melanogaster OX=7227 GN=Meltrin PE=1 SV=1
9	PDB:4q1lA	0.117	0.860	9.101E-15	202	0.038	0.302	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
10	AFDB:Q9VAI2	0.160	0.165	3.680E-10	1537	0.125	0.130	Q9VAI2.pdb.gz	Q9VAI2_DROME Kuzbanian-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Kul PE=4 SV=1
11	PDB:1w0rA	0.046	0.120	6.869E-8	442	0.036	0.131	1w0rA.pdb.gz
12	PDB:7ufgA	0.087	0.113	5.086E-6	1151	0.065	0.089	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:7ufgB	0.095	0.120	2.937E-5	1182	0.066	0.090	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	AFDB:A0A024R064	0.036	0.060	9.259E-5	852	0.065	0.122	A0A024R064.pdb.gz
15	PDB:7nydE	0.044	0.119	1.990E-4	484	0.038	0.124	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4e0sB	0.037	0.060	1.149E-3	898	0.029	0.051	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
17	PDB:7nydG	0.037	0.117	1.149E-3	413	0.027	0.104	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:7nycC	0.031	0.059	2.992E-3	809	0.019	0.037	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4a5wB	0.033	0.057	3.327E-3	871	0.014	0.026	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
20	PDB:3t5oA	0.035	0.060	5.090E-3	871	0.026	0.047	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1A5	0.0	703	1117	0.256	0.365	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	D3ZLL7	0.0	633	1221	0.235	0.306	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
3	E7FEJ5	0.0	608	1244	0.225	0.288	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
4	P58397	0.0	3311	1594	1.000	1.000	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
5	Q4VC17	0.0	618	1219	0.238	0.311	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
6	Q68SA9	0.0	1348	1657	0.462	0.444	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
7	Q69Z28	0.0	611	1222	0.231	0.302	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
8	Q811B3	0.0	2631	1600	0.802	0.799	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
9	Q8TE60	0.0	635	1221	0.235	0.307	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
10	Q9H324	0.0	617	1103	0.232	0.335	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
11	Q9UKP4	0.0	1152	1686	0.350	0.331	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
12	Q9UKP5	0.0	697	1117	0.251	0.358	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
13	Q9W493	5.94e-172	547	1023	0.182	0.283	Q9W493_DROME ADAM metallopeptidase with thrombospondin type 1 motif B, isoform B OS=Drosophila melanogaster OX=7227 GN=AdamTS-B PE=4 SV=3
14	P59511	4.00e-160	535	1906	0.220	0.184	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
15	D3YX90	4.15e-158	512	1095	0.206	0.300	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
16	Q9P2N4	1.14e-157	529	1935	0.225	0.185	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
17	E7FFX0	6.80e-157	512	1224	0.187	0.243	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
18	P59510	3.22e-152	513	1910	0.213	0.177	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
19	E9PUN6	4.56e-150	508	1931	0.216	0.178	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
20	Q9WUQ1	5.75e-147	478	967	0.196	0.324	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	1e-16	72.5	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	8.4e-07	40.4	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	4.2e-25	99.7	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	2.6e-27	107.2	Reprolysin family propeptide
5	PF08686 PLAC	8.6e+02	12.1	PLAC (protease and lacunin) domain
6	PF01421 Reprolysin	6.7e-23	93.2	Reprolysin (M12B) family zinc metalloprotease
7	PF13574 Reprolysin_2	0.61	21.5	Metallo-peptidase family M12B Reprolysin-like
8	PF13582 Reprolysin_3	0.00011	34.0	Metallo-peptidase family M12B Reprolysin-like
9	PF13583 Reprolysin_4	0.91	20.7	Metallo-peptidase family M12B Reprolysin-like
10	PF13688 Reprolysin_5	2.6e-10	52.3	Metallo-peptidase family M12
11	PF19030 TSP1_ADAMTS	8.9e-72	248.6	Thrombospondin type 1 domain
12	PF19035 TSP1_CCN	1.8e-11	55.5	CCN3 Nov like TSP1 domain
13	PF19028 TSP1_spondin	9.6e-05	34.0	Spondin-like TSP1 domain
14	PF00090 TSP_1	4.7e-30	114.8	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343002	0.957	Beta-1,3-glucosyltransferase
2	9606.ENSP00000373472	0.944	A disintegrin and metalloproteinase with thrombospondin motifs 7
3	9606.ENSP00000260356	0.939	Thrombospondin-1
4	9606.ENSP00000369921	0.937	ADAMTS-like protein 1
5	9606.ENSP00000355751	0.926	Thrombospondin-2
6	9606.ENSP00000418735	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 9
7	9606.ENSP00000286744	0.923	ADAMTS-like protein 3
8	9606.ENSP00000251582	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 2
9	9606.ENSP00000360997	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 13
10	9606.ENSP00000362304	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 14
11	9606.ENSP00000374071	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 20
12	9606.ENSP00000274487	0.920	ADAM metallopeptidase with thrombospondin type 1 motif 19
13	9606.ENSP00000284984	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 1
14	9606.ENSP00000284987	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 5
15	9606.ENSP00000299164	0.920	ADAM metallopeptidase with thrombospondin type 1 motif 15
16	9606.ENSP00000286657	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 3
17	9606.ENSP00000356975	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 4
18	9606.ENSP00000268070	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 17
19	9606.ENSP00000347484	0.915	Thrombospondin type-1 domain-containing protein 4
20	9606.ENSP00000358035	0.915	ADAMTS-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	1.000	metallopeptidase activity
GO:0004175	1.000	endopeptidase activity
GO:0005515	0.999	protein binding
GO:0004222	0.986	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0032501	0.980	multicellular organismal process
GO:0048856	0.980	anatomical structure development
GO:0050789	0.971	regulation of biological process
GO:0007275	0.944	multicellular organism development
GO:0071704	0.935	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0019538	0.880	protein metabolic process
GO:0048513	0.873	animal organ development
GO:0043062	0.869	extracellular structure organization
GO:0009100	0.867	glycoprotein metabolic process
GO:0006029	0.835	proteoglycan metabolic process
GO:0048731	0.808	system development
GO:0050794	0.777	regulation of cellular process
GO:0045229	0.708	external encapsulating structure organization
GO:0030198	0.639	extracellular matrix organization
GO:0050896	0.594	response to stimulus
GO:0048519	0.535	negative regulation of biological process
GO:0001503	0.515	ossification
GO:0051239	0.494	regulation of multicellular organismal process
GO:0006508	0.469	proteolysis
GO:0048583	0.464	regulation of response to stimulus
GO:0001501	0.439	skeletal system development
GO:0009888	0.415	tissue development
GO:0050793	0.356	regulation of developmental process
GO:0048523	0.356	negative regulation of cellular process
GO:0097435	0.346	supramolecular fiber organization
GO:0030199	0.313	collagen fibril organization
GO:2000026	0.308	regulation of multicellular organismal development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0071944	0.993	cell periphery
GO:0005576	0.966	extracellular region
GO:0031012	0.956	extracellular matrix
GO:0062023	0.954	collagen-containing extracellular matrix
GO:0012505	0.941	endomembrane system
GO:0031974	0.909	membrane-enclosed lumen
GO:0070013	0.891	intracellular organelle lumen
GO:0043227	0.734	membrane-bounded organelle
GO:0043231	0.690	intracellular membrane-bounded organelle
GO:0005737	0.503	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.986	Metalloendopeptidases.

[back to server]