StarFunc result for job id P58417

User Input

>input (271 residues)
MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS
QTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFG
WGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQ
QTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICI
YISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61200	0.649	0.649	1.963E-46	271	0.996	0.996	Q61200.pdb.gz	NXPH1_MOUSE Neurexophilin-1 OS=Mus musculus OX=10090 GN=Nxph1 PE=2 SV=2
2	AFDB:Q61199	0.629	0.652	2.025E-31	261	0.590	0.613	Q61199.pdb.gz	NXPH2_MOUSE Neurexophilin-2 OS=Mus musculus OX=10090 GN=Nxph2 PE=2 SV=2
3	AFDB:Q91VX5	0.550	0.590	3.763E-27	252	0.461	0.496	Q91VX5.pdb.gz	NXPH3_MOUSE Neurexophilin-3 OS=Mus musculus OX=10090 GN=Nxph3 PE=2 SV=1
4	AFDB:G3X9N5	0.519	0.464	3.106E-22	304	0.424	0.378	G3X9N5.pdb.gz	G3X9N5_MOUSE Neurexophilin OS=Mus musculus OX=10090 GN=Nxph4 PE=1 SV=1
5	AFDB:Q6P5E6	0.189	0.104	1.098E-5	603	0.137	0.061	Q6P5E6.pdb.gz	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
6	AFDB:A0A0G2JV04	0.210	0.095	2.252E-5	727	0.129	0.048	A0A0G2JV04.pdb.gz	GGA3_RAT ADP-ribosylation factor-binding protein GGA3 OS=Rattus norvegicus OX=10116 GN=Gga3 PE=1 SV=1
7	AFDB:Q9UJY4	0.209	0.108	3.314E-5	613	0.096	0.042	Q9UJY4.pdb.gz	GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3
8	AFDB:Q84K16	0.185	0.076	4.368E-5	876	0.144	0.045	Q84K16.pdb.gz	AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA-ADR PE=1 SV=1
9	AFDB:B3KXW5	0.172	0.073	4.695E-4	845	0.089	0.028	B3KXW5.pdb.gz	B3KXW5_HUMAN AP-1 complex subunit gamma OS=Homo sapiens OX=9606 PE=2 SV=1
10	AFDB:O77290	0.204	0.062	1.075E-3	1160	0.122	0.028	O77290.pdb.gz	O77290_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=2 SV=1
11	PDB:3b07A	0.208	0.200	1.215E-2	284	0.055	0.053	3b07A.pdb.gz
12	PDB:4mmhA	0.126	0.071	1.284E-2	637	0.066	0.028	4mmhA.pdb.gz	Crystal Structure of Pedobacter heparinus Heparin Lyase Hep III with the Active Site in a Deep Cleft
13	PDB:2jkrM	0.171	0.124	3.106E-2	409	0.048	0.032	2jkrM.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
14	PDB:3es6A	0.229	0.224	3.106E-2	277	0.052	0.051	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
15	PDB:5mj3A	0.189	0.174	3.665E-2	302	0.044	0.040	5mj3A.pdb.gz
16	PDB:7kzpB	0.130	0.064	3.873E-2	701	0.048	0.019	7kzpB.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
17	PDB:6cjzA	0.098	0.199	5.105E-2	105	0.033	0.086	6cjzA.pdb.gz
18	PDB:1ngwH	0.164	0.192	7.111E-2	216	0.048	0.060	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
19	PDB:3alaD	0.100	0.045	7.111E-2	711	0.055	0.021	3alaD.pdb.gz	A new crystal form of human vascular adhesion protein 1
20	PDB:4h56A	0.168	0.170	7.514E-2	267	0.055	0.056	4h56A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61200	0.0	562	271	0.996	0.996	NXPH1_MOUSE Neurexophilin-1 OS=Mus musculus OX=10090 GN=Nxph1 PE=2 SV=2
2	Q61199	1.05e-111	324	261	0.546	0.567	NXPH2_MOUSE Neurexophilin-2 OS=Mus musculus OX=10090 GN=Nxph2 PE=2 SV=2
3	Q91VX5	3.39e-87	261	252	0.513	0.552	NXPH3_MOUSE Neurexophilin-3 OS=Mus musculus OX=10090 GN=Nxph3 PE=2 SV=1
4	G3X9N5	3.12e-70	220	304	0.424	0.378	G3X9N5_MOUSE Neurexophilin OS=Mus musculus OX=10090 GN=Nxph4 PE=1 SV=1
5	Q8BTD1	3.79e-30	114	215	0.218	0.274	Q8BTD1_MOUSE Neurexophilin OS=Mus musculus OX=10090 GN=Nxph4 PE=2 SV=1
6	Q969Y0	8.89e-06	48.9	559	0.122	0.059	NXPE3_HUMAN NXPE family member 3 OS=Homo sapiens OX=9606 GN=NXPE3 PE=1 SV=1
7	Q6PI26	0.035	37.7	577	0.125	0.059	SHQ1_HUMAN Protein SHQ1 homolog OS=Homo sapiens OX=9606 GN=SHQ1 PE=1 SV=2
8	Q727C7	0.19	35.8	1372	0.070	0.014	RPOB_DESVH DNA-directed RNA polymerase subunit beta OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=rpoB PE=1 SV=1
9	A0A8I6ASE2	0.25	35.4	1956	0.066	0.009	A0A8I6ASE2_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
10	D4A5A6	0.25	35.4	1970	0.066	0.009	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
11	G3MZY8	0.26	35.4	1970	0.066	0.009	G3MZY8_BOVIN DNA-directed RNA polymerase subunit OS=Bos taurus OX=9913 GN=POLR2A PE=1 SV=2
12	P08775	0.26	35.4	1970	0.066	0.009	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3
13	P24928	0.26	35.4	1970	0.066	0.009	RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2
14	Q8N323	4.7	31.2	547	0.070	0.035	NXPE1_HUMAN NXPE family member 1 OS=Homo sapiens OX=9606 GN=NXPE1 PE=1 SV=2
15	P04052	4.8	31.2	1887	0.059	0.008	RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4
16	P08121	8.2	30.4	1464	0.055	0.010	CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus OX=10090 GN=Col3a1 PE=1 SV=4
17	Q6UWF7	8.8	30.4	544	0.074	0.037	NXPE4_HUMAN NXPE family member 4 OS=Homo sapiens OX=9606 GN=NXPE4 PE=2 SV=1
18	Q96DL1	8.9	30.4	559	0.074	0.036	NXPE2_HUMAN NXPE family member 2 OS=Homo sapiens OX=9606 GN=NXPE2 PE=1 SV=2
19	Q5VW36	9.1	30.4	1801	0.055	0.008	FOCAD_HUMAN Focadhesin OS=Homo sapiens OX=9606 GN=FOCAD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00630 Filamin	2.6e+02	13.9	Filamin/ABP280 repeat
2	PF06312 Neurexophilin	1.4e-110	379.3	Neurexophilin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385142	0.988	Neurexin-1
2	9606.ENSP00000265459	0.984	Neurexin-2
3	9606.ENSP00000451648	0.849	Neurexin-3
4	9606.ENSP00000355621	0.623	Tetratricopeptide repeat domain containing
5	9606.ENSP00000438209	0.623	Transcription factor Sp6
6	9606.ENSP00000482228	0.601	Pleckstrin homology domain-containing family A member 2
7	9606.ENSP00000354536	0.597	Astrotactin-1
8	9606.ENSP00000295057	0.575	Leucine-rich repeat transmembrane neuronal protein 1
9	9606.ENSP00000364627	0.565	NXPE family member 4
10	9606.ENSP00000402153	0.539	IQ motif containing J
11	9606.ENSP00000375647	0.536	Voltage-dependent calcium channel gamma-7 subunit
12	9606.ENSP00000064571	0.531	Cerebellin-4
13	9606.ENSP00000469474	0.531	Coiled-coil domain containing 177
14	9606.ENSP00000330633	0.522	Contactin-2
15	9606.ENSP00000335038	0.516	V-set and transmembrane domain containing 2B
16	9606.ENSP00000418994	0.509	Synaptoporin
17	9606.ENSP00000349594	0.501	ELAV-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0048519	0.948	negative regulation of biological process
GO:0048518	0.748	positive regulation of biological process
GO:0048522	0.459	positive regulation of cellular process
GO:0050896	0.411	response to stimulus
GO:0032501	0.408	multicellular organismal process
GO:0019222	0.394	regulation of metabolic process
GO:0007154	0.387	cell communication
GO:0048523	0.386	negative regulation of cellular process
GO:0023052	0.353	signaling
GO:0060255	0.334	regulation of macromolecule metabolic process
GO:0080090	0.322	regulation of primary metabolic process
GO:0051171	0.318	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.982	cytoplasm
GO:0031974	0.960	membrane-enclosed lumen
GO:0005886	0.946	plasma membrane
GO:0031981	0.946	nuclear lumen
GO:0005654	0.927	nucleoplasm
GO:0005829	0.578	cytosol
GO:0012505	0.536	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]